Identifiers and Description

Gene Model Identifier

TTHERM_00066840

Standard Name

CYC26 (CYClin)

Aliases

PreTt13174 | 4.m00573 | 3707.m00211

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00066840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02084.19.997093137033517e-262cyclin domain-containing prote
in (583 aa)
OxytrichaContig10351.0.g121.999598840915195e-17Cyclin, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00066840(coding)
ATGAGCACTGATAAAGTTTATTCTGCTGATTCTATTGCCTCTCGCGACTCAGTTGAGGGC
CAATGCTACAAAACTTCTGAATATTTTCCTTGTCCACACATTAAAACTATTAAGCATAAG
ACAAGACTTAATTGCTTCAAATGTGGTCTATGTCTTCACGATGGAGCAAAAGCTTACAAG
ACATAAAATATGAAATATGGCACATACTTTGATCCTAGCAAATTCTTTTCATCATGCTTG
AAGCAAAAGCTACCTTAAATAGTTATTGACAAGGAATCTGAATATTACAAGAATAGAAAT
TAGTTGCTTGATTTGCTTTACGATACCAGTCATAGCTTAAAACTCACAGTCAATACAACT
CATTTAGCAGTTATGTTTATGGATTTCGCCTTAAGCAGAATCCATTCTGTTTCTTACAAG
ACTATGCAAATTTATGCAGCTACCTGTGTTATGCTTGCTGCTAAAACTATTGAGTTAGAT
GAAAGAATCCCTTTTATTTCAAAATTGAAAAGATACTCTAATTTGGTTTCATATGATTCT
AAAGAGTTCTACTAAGTTGAATAATCAATTCTAAAAGAACTTAATTGGAACTTATAATGC
GTTACCCCTATTGATGTCATCGAGTACTATCTCAGTCAAGGAATTGTTTTTTCAACTGAT
TAATTTACTGAAGAGAGTTCAAGTAATTCAAGTTTCAATGAAGAAAATGCTCTTAAAGAG
AAGCATAATTAGAACGATACTACTCCTAGCGCTTTATCAAATAAAAACTCTAATTCTGTT
ACAAATAAGGCATAAGGATTAAAGAATGACGAAAACAAAGACTTCACTTCAGCATTAAAT
AATCTTTCTATCGGAGAAAAGGAGAATAGCGGTACTACTTATGTAGGTTCTTGCAGCTCA
ACTAATAACTTGAAGAAGAAAGTTTAAATTAGCGACTTAAATGACTCTCGTATCTTCCAA
ATAGTCTAAAAAATAGAAAAAGACTATTCTCGCCTCGCTAATCTCATAATTAGAGATCAT
AGATTTAACGATTTCCACATTAAGGTTATTTCTGCAGCCAGTGTTTGCTTCTTAAGAAAG
ATTAATGGTATTACTCCTGCTTGGAATAAACAATTAACTTCTTTAAGTAATAACTTAATC
AATGAGTCTATGTTTTAAGATTGTTTGAATATCTTAGAAAGCAAATTCTCTTCATAATTT
TAACCTGTATAAACAAATACTATTGCTAAACGTCCTGCAGTATTAAGCATTAACAATTCA
AATATGCTTCTTCGTGATTCTGAAAGTTAGAACAAAGCTCCTACTAGCTCTTCTATTCCC
ACAAAATTCAATTACAGAAACAATCTTTCCACCCATACAAGCAATCATAAGGTACCCACT
GGAGAGAATACTTATAAAGTGATAACCAAGCCTTTGCAATTCAGTCACACAAATAATAAC
AATATTTATTGTGACAATGACTTACCTACTCAATATAGCGTTCTTAGTAATGCAAGTACA
AATACTGTATTGACTAATAAAAGTAACTACACAAACTATCAATACAATAATAGCTATTTA
AGTAGTTAGAATGTGCACCATCACCAAATAGGGTATGGAGGAAACTCAGCTAATAACCAA
AACATCTATCCTTCTTCAAGTTTATTATCTACAAACAATACATATTTAAAGCATGGAAAT
GCTTAGCAATAACACAAAAGCTATATATTATAAACTAGAAGTGATTCTAACTTTCTTTGA


>TTHERM_00066840(protein)
MSTDKVYSADSIASRDSVEGQCYKTSEYFPCPHIKTIKHKTRLNCFKCGLCLHDGAKAYK
TQNMKYGTYFDPSKFFSSCLKQKLPQIVIDKESEYYKNRNQLLDLLYDTSHSLKLTVNTT
HLAVMFMDFALSRIHSVSYKTMQIYAATCVMLAAKTIELDERIPFISKLKRYSNLVSYDS
KEFYQVEQSILKELNWNLQCVTPIDVIEYYLSQGIVFSTDQFTEESSSNSSFNEENALKE
KHNQNDTTPSALSNKNSNSVTNKAQGLKNDENKDFTSALNNLSIGEKENSGTTYVGSCSS
TNNLKKKVQISDLNDSRIFQIVQKIEKDYSRLANLIIRDHRFNDFHIKVISAASVCFLRK
INGITPAWNKQLTSLSNNLINESMFQDCLNILESKFSSQFQPVQTNTIAKRPAVLSINNS
NMLLRDSESQNKAPTSSSIPTKFNYRNNLSTHTSNHKVPTGENTYKVITKPLQFSHTNNN
NIYCDNDLPTQYSVLSNASTNTVLTNKSNYTNYQYNNSYLSSQNVHHHQIGYGGNSANNQ
NIYPSSSLLSTNNTYLKHGNAQQQHKSYILQTRSDSNFL


>TTHERM_00066840(gene)
ATGAGCACTGATAAAGTTTATTCTGCTGATTCTATTGCCTCTCGCGACTCAGTTGAGGGC
CAATGCTACAAAACTTCTGAATATTTTCCTTGTCCACACATTAAAACTATTAAGCATAAG
ACAAGACTTAATTGCTTCAAATGTGGTCTATGTCTTCACGTAAGCACTTTATTTTAATGA
ATATAGTTTAGATTATGCAGCTACTAAACCAAGCAAACTCATCTAAATATTTATTTTATC
TTATAGGATGGAGCAAAAGCTTACAAGACATAAAATATGAAATATGGCACATACTTTGAT
CCTAGCAAATTCTTTTCATCATGCTTGAAGCAAAAGCTACCTTAAATAGTTATTGACAAG
GAATCTGAATATTACAAGGTAATCTACTTATGCGCTAAATATTATAAATCTAAAAAACAC
ATAGAATCCCAATTACACTATTTTATTAACAAGAATTATATTCAACAAATTCTACTTGTT
TGTTTTGAGTTGATAGTGTTTAACTCTCAACTATTTAATATTTTATTTCAAAAAAATATA
AAAAGACTTAACTGAATAATAAATTTATTATATTTTTTAATATAAACCAGAATAGAAATT
AGTTGCTTGATTTGCTTTACGATACCAGTCATAGCTTAAAACTCACAGTCAATACAACTC
ATTTAGCAGTTATGTTTATGGATTTCGCCTTAAGCAGAATCCATTCTGTTTCTTACAAGA
CTATGCAAATTTATGCAGCTACCTGTGTTATGCTTGCTGGTAATTTACATTTTATTTAAT
TTCGCAAAATATTTCTTCTTCAACAACAATAATTGATTTCTAATCTTACTTTTTGATATC
TATAAATAAATACATTGATTAATTGATTGCATTTATTATGAAAAGCCTTATCGAAATTTA
AATATTTGATTCTATAGATAAAAAAATAAAGAGAATAATTTGAATAATAAATAAGCAAAA
CGTAATTAATTTACTTACTAACAAAAAATCTGTATAAATTCATTTAAAAATTAGAGTTGT
TAACACAGAAATTTATAGTAGATAAAAATTAAATAAAACCTAAAAATTGTTTTGAAAATC
AAAAAAATTATTTTTATTCAAAAAAAATATAGAAAAATTATTAATGATAAAATATAATTT
TTAAATAAAATTATCGCTCGTTTTTGAAAGAAAAATAGATTATTAATTCCTTCTTTAATC
ATAGAAAATCAAAATTTGTTGTGAGGAAAATAAATAAAAATTCAATATAATTTATACTGA
ATTCAAATGAATTTGTTTTTTATAAAATAAAAGCTAAAACTATTGAGTTAGATGAAAGAA
TCCCTTTTATTTCAAAATTGAAAAGATACTCTAATTTGGTTTCATATGATTCTAAAGAGT
TCTACTAAGTTGAATAATCAATTCTAAAAGAACTTAATTGGAACTTATAATGCGTTACCC
CTATTGATGTCATCGAGTACTATCTCAGTCAAGGAATTGTTTTTTCAACTGATTAATTTA
CTGAAGAGAGTTCAAGTAATTCAAGTTTCAATGAAGAAAATGCTCTTAAAGAGAAGCATA
ATTAGAACGATACTACTCCTAGCGCTTTATCAAATAAAAACTCTAATTCTGTTACAAATA
AGGCATAAGGATTAAAGAATGACGAAAACAAAGACTTCACTTCAGCATTAAATAATCTTT
CTATCGGAGAAAAGGAGAATAGCGGTACTACTTATGTAGGTTCTTGCAGCTCAACTAATA
ACTTGAAGAAGAAAGTTTAAATTAGCGACTTAAATGACTCTCGTATCTTCCAAATAGTCT
AAAAAATAGAAAAAGACTATTCTCGCCTCGCTAATCTCATAATTAGAGGTAAAAAATATT
TTATTGGAAAAAGACAAAATAATTTTTAAAAATTTTTGATTTTAATCATTTTTTAATTCA
AATTATTTGAATTAATTTTTTAGAATAGCAAAATAAAATTTAAAAGTAATTTTAATATTA
ATTTATTGATTAATTTTTGCAATTTTGAAAATAAAAATAAATATTTTTAATTTAATTAGA
TCATAGATTTAACGATTTCCACATTAAGGTTATTTCTGCAGCCAGTGTTTGCTTCTTAAG
AAAGATTAATGGTATTACTCCTGCTTGGAATAAACAATTAACTTCTTTAAGTAATAACTT
AATCAATGAGTCTATGTTTTAAGATTGTTTGAATATCTTAGAAAGCAAATTCTCTTCATA
ATTTTAACCTGTATAAACAAATACTATTGCTAAACGTCCTGCAGTATTAAGCATTAACAA
TTCAAATATGCTTCTTCGTGATTCTGAAAGTTAGAACAAAGCTCCTACTAGCTCTTCTAT
TCCCACAAAATTCAATTACAGAAACAATCTTTCCACCCATACAAGCAATCATAAGGTACC
CACTGGAGAGAATACTTATAAAGTGATAACCAAGCCTTTGCAATTCAGTCACACAAATAA
TAACAATATTTATTGTGACAATGACTTACCTACTCAATATAGCGTTCTTAGTAATGCAAG
TACAAATACTGTATTGACTAATAAAAGTAACTACACAAACTATCAATACAATAATAGCTA
TTTAAGTAGTTAGAATGTGCACCATCACCAAATAGGGTATGGAGGAAACTCAGCTAATAA
CCAAAACATCTATCCTTCTTCAAGTTTATTATCTACAAACAATACATATTTAAAGCATGG
AAATGCTTAGCAATAACACAAAAGCTATATATTATAAACTAGAAGTGATTCTAACTTTCT
TTGA