Identifiers and Description

Gene Model Identifier

TTHERM_00717540

Standard Name

CYC25 (CYClin 25)

Aliases

PreTt10852 | 114.m00087 | 3827.m00930

Description

CYC25 amine-terminal domain cyclin; Cyclin- N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00717540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07439.11.0000732791548452e-89hypothetical protein (2016 aa)
OxytrichaContig14167.0.g674.0006511639687014e-23Cyclin, N-terminal domain
WormBaseWBGene000008710.00000000000020009182674645818locus:cye-1 G1/S-specific cy
clin-E status:Confirmed Un
iProt:O01501 protein_id:CCD6
6922.1
Stentor CoeruleusSteCoe_156120.0000000000002543665647376923
SGDYPR119W0.000000000010004361180063202CLB2 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the tra
nsition from G2 to M phase; ac
cumulates during G2 and M, the
n targeted via a destruction b
ox motif for ubiquitin-mediate
d degradation by the proteasom
e

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00717540(coding)
ATGAGTTAATTTCCTCAAAACGTTGTGATTTCGACTAATAAAATTCAACCTTAGTAACTT
ATCAACAAGCAGCAACAAATTTCTTCATAATCATTTACAACTAGAGTTATTAATAACAAT
GTAGGATTTTCTAAAGATTTATACAGATAAGTTTTAGGGTACAACAATAATGAATTAGAC
TGCTACAATCCTTAAACTAGACTTAACACAGTAAGCAGTAAGTCTTCTTATAACTCAAAA
CATTTCGCCTTGCCTTAAGAGAAGCTACTGAGCTTTACAAGACTATCATAAAACGTGTAG
ACGAACTAAACCAATAATGCACCATATCAGCAACAAGATACTGATTAAAGGTTAGCTACT
TAAATAATAACTCCATAGAATGCTATCTCTCAGACTCATTCTTTAGTAAACACTGCTAGG
TCTTCTAACATTAATATTGTAATTAAGAAGGATATTAACAAACACTTAGCCAACATTTGT
ACTGATAATTTCTTAAGTGCAAGAGAAGCAGCTCTAGAGTAGAGATGCAATCAAAATTAA
AAATAGCAATAACAACTTTAGAACAGCATCAAACCTATTTTGGCTCAGAAGAATATCTAA
AATGAACTAAATACCAATCCTTAATAAATATTAAAGGTAAATGTTAACTCCAATTTTCTT
CACCAACACTAGCTAGATTAAAAGACTTTTCAAAGTAAAGAAAACTTTCAACAAAAAGCT
TATTAAAAAGAATATACTGATTATAAAAATACTTCAAAATAAAATAGTGCCTTACTAAAT
GGATAAAGTAATTTAGGTAATTTAGAAATAAATAAGAATAGTCAAATAAATAATCGTTTT
ATAAAAATTGGAGAGTTAGAGAAAAACAACACAATTCATCAAATAGGAGAAGATAAACTG
ACTCAAAGAAGATCATCAATATATTTTTAAGGATAAGATTAAATAATATAAGAAGTCGCT
TAAAACAATATTTATAGATAGAACGATGTGCTAATAGAATAATAATTTTAGTAATCTTAA
AGTTAACAAGAATAAACAAATAGCTTTAGTTAGATTACAAATAATATTAAAAATAATTAA
ATAATTCATGACAAAAATACCATTTAATAATAATAATAATAATAATAATCTTATAAGTAA
TATTAGTAAGTTAATTGCTTTTTAAACAATCCATATTCTGTATATTCTCAAAAAAGTTAA
TTTGAAAGTATTCAATCATATAGGTTGTAAGAAGATACTCAGAAATTAGTAGAACAAACT
CAAAGTAGCATTAATTAGAATATACATAAAATAAGTATAAACAATGCTTTTTAAAGTTAA
AACAACAAAGAACTTGAAGCTACTATCTCTCAATAGACATATGATAACTTCCAGTAAAAT
TAATTTAAGGCCTTACCAAAAAATCAGCAGTAATATTAGCATTTTGAGATAAATAGCCAA
AACTCTTAAACAGCTGGAAATTAATAATTTAATTCAAGAAAAATGAGCTATAAACACGAA
ATATATCCTCCCTCTTTGAATGATATTCTTTCTGGTTCACAGTATGCATCTTAAAAAAAT
TTAATAAGCCAACAAGAAATTGAAATAATCAAATGTCTTAAGTGGAAACTCAATCCCATA
ACTGCTTGCTATTGGATGGATTTGGCTATGGCACAATGGGATAGTATTCAATAGGTATAA
AGTAAATCTTGTATTTTCTTTAGAAAAAGAGATGAGCAATCCTATAAAAGATACAGAGAG
GCTTACTAATTTTTAGATTTTATTATTCTTGATTCAAACAAAATGAAATATTCTTTGAGA
TTAATCACTATCACTTCAATATATTTAGTTATTTGTAAATACTATGCTATTAATCCTGAA
TAGCCAAATAACTAAATTGACTAAATATTTTAATAACAGAGCTATTTATAAATGTTTTAA
TTAAATATTAATCTAATTAAGTAGTGTTCTAAGGAATTAAATAGTTTCTTTACAAGTTTG
GCTTACGACTTTGATTACCCAAATGCTATTAAATAAAATAATTTTAACTAGAAAAGTTAT
GAAGAATTTTTATCTTTTTAGTCATACAGTTAACTTAACAAATAAAATTTAGAAAGTTTA
CTAAAATAAAATTAAAAATTTAATTTATGA


>TTHERM_00717540(protein)
MSQFPQNVVISTNKIQPQQLINKQQQISSQSFTTRVINNNVGFSKDLYRQVLGYNNNELD
CYNPQTRLNTVSSKSSYNSKHFALPQEKLLSFTRLSQNVQTNQTNNAPYQQQDTDQRLAT
QIITPQNAISQTHSLVNTARSSNINIVIKKDINKHLANICTDNFLSAREAALEQRCNQNQ
KQQQQLQNSIKPILAQKNIQNELNTNPQQILKVNVNSNFLHQHQLDQKTFQSKENFQQKA
YQKEYTDYKNTSKQNSALLNGQSNLGNLEINKNSQINNRFIKIGELEKNNTIHQIGEDKL
TQRRSSIYFQGQDQIIQEVAQNNIYRQNDVLIEQQFQQSQSQQEQTNSFSQITNNIKNNQ
IIHDKNTIQQQQQQQQSYKQYQQVNCFLNNPYSVYSQKSQFESIQSYRLQEDTQKLVEQT
QSSINQNIHKISINNAFQSQNNKELEATISQQTYDNFQQNQFKALPKNQQQYQHFEINSQ
NSQTAGNQQFNSRKMSYKHEIYPPSLNDILSGSQYASQKNLISQQEIEIIKCLKWKLNPI
TACYWMDLAMAQWDSIQQVQSKSCIFFRKRDEQSYKRYREAYQFLDFIILDSNKMKYSLR
LITITSIYLVICKYYAINPEQPNNQIDQIFQQQSYLQMFQLNINLIKQCSKELNSFFTSL
AYDFDYPNAIKQNNFNQKSYEEFLSFQSYSQLNKQNLESLLKQNQKFNL


>TTHERM_00717540(gene)
ATGAGTTAATTTCCTCAAAACGTTGTGATTTCGACTAATAAAATTCAACCTTAGTAACTT
ATCAACAAGCAGCAACAAATTTCTTCATAATCATTTACAACTAGAGTTATTAATAACAAT
GTAGGATTTTCTAAAGATTTATACAGATAAGTTTTAGGGTACAACAATAATGAATTAGAC
TGCTACAATCCTTAAACTAGACTTAACACAGTAAGCAGTAAGTCTTCTTATAACTCAAAA
CATTTCGCCTTGCCTTAAGAGAAGCTACTGAGCTTTACAAGACTATCATAAAACGTGTAG
ACGAACTAAACCAATAATGCACCATATCAGCAACAAGATACTGATTAAAGGTTAGCTACT
TAAATAATAACTCCATAGAATGCTATCTCTCAGACTCATTCTTTAGTAAACACTGCTAGG
TCTTCTAACATTAATATTGTAATTAAGAAGGATATTAACAAACACTTAGCCAACATTTGT
ACTGATAATTTCTTAAGTGCAAGAGAAGCAGCTCTAGAGTAGAGATGCAATCAAAATTAA
AAATAGCAATAACAACTTTAGAACAGCATCAAACCTATTTTGGCTCAGAAGAATATCTAA
AATGAACTAAATACCAATCCTTAATAAATATTAAAGGTAAATGTTAACTCCAATTTTCTT
CACCAACACTAGCTAGATTAAAAGACTTTTCAAAGTAAAGAAAACTTTCAACAAAAAGCT
TATTAAAAAGAATATACTGATTATAAAAATACTTCAAAATAAAATAGTGCCTTACTAAAT
GGATAAAGTAATTTAGGTAATTTAGAAATAAATAAGAATAGTCAAATAAATAATCGTTTT
ATAAAAATTGGAGAGTTAGAGAAAAACAACACAATTCATCAAATAGGAGAAGATAAACTG
ACTCAAAGAAGATCATCAATATATTTTTAAGGATAAGATTAAATAATATAAGAAGTCGCT
TAAAACAATATTTATAGATAGAACGATGTGCTAATAGAATAATAATTTTAGTAATCTTAA
AGTTAACAAGAATAAACAAATAGCTTTAGTTAGATTACAAATAATATTAAAAATAATTAA
ATAATTCATGACAAAAATACCATTTAATAATAATAATAATAATAATAATCTTATAAGTAA
TATTAGTAAGTTAATTGCTTTTTAAACAATCCATATTCTGTATATTCTCAAAAAAGTTAA
TTTGAAAGTATTCAATCATATAGGTTGTAAGAAGATACTCAGAAATTAGTAGAACAAACT
CAAAGTAGCATTAATTAGAATATACATAAAATAAGTATAAACAATGCTTTTTAAAGTTAA
AACAACAAAGAACTTGAAGCTACTATCTCTCAATAGACATATGATAACTTCCAGTAAAAT
TAATTTAAGGCCTTACCAAAAAATCAGCAGTAATATTAGCATTTTGAGATAAATAGCCAA
AACTCTTAAACAGCTGGAAATTAATAATTTAATTCAAGAAAAATGAGCTATAAACACGTA
ATATATATCTATTTTTAACATGAAATAACATTTTTATTATTTTTTCATATATTAATTCAC
TCAAATAGTCAATCAAAAACTTATTTTCTATACTAAACAATCACAAAATTAAAAAATCCT
TTTCTAATTGAAAAAAAAATTAAAATAAAGCCATTATTATAAAAATGAAATAGAATTTAT
AAATAAAGGTTTGAATTGAGTTAAAAATTTCTCATTATAAATTAATTTTAATTTCAAAGA
TTTATTTAAATAGATATTCAAATAAATTTATTAAGATATCTTATAAAGATATTAAAGAGA
AAATGTTATTATCAAATAAGAAAAAAATAGAAAGTTCACTAATTTAATTAAAATCAAAGT
AAATCAATCAATTTTTTTATTTATATTGTAGGATATAGGAGTAGATGATTTTTAGTTGAG
GAGAATCTAAGATATAACTCCATAAAATGGAATATAAGAATAGGTTTAATATTAAAGTAG
CTAAGAAATCGGGACATAGCAGCCATATTTATATCTGGTACCATAAAAGGTTTCAAGATA
GAGAAATAAGACTGCAATTAATCATGCAGATTAGAATATAAGAAATGTTAAGACGAGCAC
AAATAACCTGTCTGTGTATATGTAAACTGTATATACAAATAGATCGCATGATATCGCAAC
TAATAATAATCAATTAGAAAATAGTTATTTGAATGAAATAACCCCTGCTTCAACAAGATC
AATCTAATAATCTTAGCTATTAACATAATAAAATAGTTAGTTCCAGTAAAGAAATTATAG
CTAAAATGAATAGTATTTAACCTAAATAGATTAAATCAGTAACTACAACTCTTACAGCCA
TAGGCAGAGCAGGATTACTAGATAGAATCCTGATTTTAATGCTGCTGAAGTTTCAGATAA
TAACAATTATTATGGATATTAAGAAAATAGTCATAAATAATACTCTAATATTTATAACTT
TCCAACCAATCAAAGCATTTCTTAAAATGAATTTTAAAAAATATAATAGGAAAAAATGAC
AAATAATATGGATTCTTCCTTTTCTCGTCAAAATAATTAATTAAAGGTTGACACAAATGT
GATCATTTAGTAGTAATAAGACTTTAGCAGTTATAGATTATAAGATTAAAAAGCAAATAA
CTAAAGCTTTTATTAGGACTAAAGATAGAATAATAATTATGAATAAATCTAAAGCTAAAT
TGATAATAACACATTTTAAAATGATCTAAATTCACTAAAGAAAATGGACACTTAAAATTA
TGACTAAATATCAAAGAGTATAGATGAAATTTTAAAAAATTTTAACTTCAAAATATCTAA
TCAACTCTCATTAACCAATAATTATTAAACAAATGCTTAAGAGTAATAGTTCTAATAAAC
TGAAAGTTAGGTTCCTATTAAAAAGGATTCATTTTAGCTATTCTCAGAATTTAATTAATA
ACAATTAAATTAGAATAATTATAAAACTAATACTTCTAGCTAGAGATAAAGTTTTTTGAA
TGGTTAAAATAACTCTTTTAATATTTATCTGGGCTAAGAAAAAATTACACCAAAGGACTA
AGGTTAAATTGACTATAACTCTTAAAATTATAGCCAAATTCCATCAGTTTAATTAGTGGG
CAATAAAATAATAGATGATTACAAGCTTGACACTCCTTTTTCGAACAGATTTTTAGGTAT
TCGAAAAAGTTCGAGGAGTTTATATACGCAGAATCAAGAAAAACAAATCGATTTTGTTAA
ATAAAGTGAAGAAGAAAAAGAATTTTAAGTTTAAAACAAAGTAAATCAATAAAATTAATA
ATTAAGCAAAGAAATAAATCAATAAAATATAGAAAAAGAAGATTAAATCCAAATTGAAAC
ATAATAAAGTGATTACAATAGTGTTAATAACATAGTTAATAATGAGCATTAAATCCCTAA
CTAAACTAAACAAACAAAGTTAAACATAAAAACATTTCAATAAACGAATACACAAACTAT
TAATACATATCCTGTAGATTAACATTTTTAAGATAGCTTTAAAGAGAACAAAAATATTGA
TTCCAGATTAGAATATTAGGGTAATAATTCTATTTTTAACTTAAAACCTTAAAATTTTTA
AACAAATAATGGATTAATTAAAAAAAGATCTTGCAAATCTTTTTTGTAGCCTAGTAACTT
AGAAAAATAAAATTTACAAGATGAAATGTTAAATTGTATTCAACAAAACTAGAAAGAATA
AAGTATGTTTTTGTTGGAAAATCAAACTGATGAAAAAAAAACTGAGTAAGACAATAAAGT
AAACACATTTAGTAAAAAAAGAGGTCTTAATACATAAATAATAAAAAATCTCTTAGTTAA
TGTTGTAGAGAGTAAATCTCTTTCAAATAGTTTTAGATAAAATAATTTAAGCAAGAATTC
AAATTCATCTGCAAATTATGATGGGAGAGGTAGCTCTTTATTAGGTCAGGCTAATAATAG
TTAATTGTGTTAGCCTGTAAATTAAAATTATATAAAAAATAGTTTTATTTTAAAAAACAA
GCTACCTCTTCAAGAAAAATCTTAAAAAAACAATTAAAGTTTGAATTTAAAACAAAAAAT
TACAATTAATGAAAAAAATAATAGTCTGAATAATTTAAATCAAAATTAAAACTTTAGTTA
AAAACTAAATACTAATGACGATTATAATAGTGAGTTCAATATTTAAAATAAGAATGAGAA
TTATGAAGAAAATAAAAATCTAAATAATTTAACTAATAATAATAAATCATGTGATATTAA
ATTCTAATAACAAAAAAACAACATTGAGCTATTTAAAAACTAAGAATTAGGAAACTTAGA
AAGTCATTTTACCGATCCAGGCAAAGGAACATTTGATAATAACTTTGTAAGTGACCCAAA
ATCTATTAATAAGGAAATTATTCCTTAAAATTTATTGAATTTTGTTAAAGATTTTAAAGA
AGAAATTCCTAAAGTAATAAAATATAGAAATAGTAAAAGTGAAGTTGAAATAAGTTAATA
AATTCCATAAATAAATTAAAATAACTAAATGCAAAAATAATAATTGATTTTAAATACTTT
AATTAATAATAAGCCTTTTAATGTTAATCAAACTTAATAACAATTAACAGTTAATGTTAA
AAATTAAAATTAACAAACTTCAAATACTGAAATAAATCATGAATAAACAAAAAAACCCTT
TCAAAATGGAAGTTTAAGCAAAAATAATAATAAGAGGAAACTAAGCTCAAATTAATCCTA
AAACTTTTAAAATAATAATAATTAATCATCTAATGAATCTTTCAAAAATTTAAAAAGTAA
TAACAGCCTGACCCAAACAATTAATTTATTACTAAACAATTTTAATGAGCGTCAAAGCTT
AGAAAAGAAAGAAAATTAAAAATTAAAATCAGCAAGAAATAGCTTGGAACTCAGCTTCAA
AGCTAGCTAGGATCAAACTAAAAGGAATACTGAAAATATTTAAGCAGTACAAGCAGTAAA
TAAATCTTTAAAAGGAAGTTTTATAAATTCACTTAATAGTTTGTCCAGCACTGCACGTAT
TGAATAAACTTATAATTAGCAAATCACTTAATAAATGATAAGCTAGAATTAAGCAGAAAA
AAATCTGTAAAATTAAAAGAAAATGTTAGCTGAATAATAACTTAGATTATCATTAATAGA
AGGTGAAATGTAAAAACAATAAATTTAAATAATTTCATATGAACCAACAAAACAAACAAA
GCAATAAAGTATTAATTCATAAAGAAGCCAAAGTGAGTATGAATATAGACAAAACATTCC
TAGTGACATACAAAAGCAAGGTATATCAGGAATTACTGACATAATATAACTAAATGAAAA
TTAAAGTGTCTTTAAACAAGATTTAAACGTTATGACATTCTGCAATAAGGATTAAAATTT
CTTTATGAATGAAACAAACTATTTAGAGAATGATGAAAATTTACCTCCTCATAGCTTAAA
TTAGAATGGATAAATGTTCTCAAATGCATTTAATAATGAAAGTATTAACAATTAAGATAA
ATCTAAATAGTCTTTAAAAGTATAAAACAGTAAATTAAATAATTAAATTATTTCTTAATC
AAAGGAAAATTAAGAAAAAGAAAATTAAAATCTCATAAATTTGAATGAAAATAATTCATA
AAAATTGCATATAGTTTCTGTATCTCTTGTAAACAGAAACCTCTCTACAGATATATTCAA
GGAAAGTATTTCACCTTTTTCTTAGCCCTATTCTTCTACTTCAAATACATCACCATCTGC
ATCTTCTATATCTTTATTCAACCTTCATTCTGTCAGTTAAAATAATTAGTAAGTTCAGGT
AAGCTTCAGATAGCTTCCACCTACCTTAACAATAGAAGAGCAAATTCAAATGTTTGATAT
TGAAGAAAAGCTAAAAAAACCTGAATTATAGCTCTAAACAGTGGAAGATATTTCAAACTT
AATAGAAGCAGAAACAACTTATTATATTGATTATAATATTTTCAGTAAAAGTAATTAGTT
CAATCACTAATCTAGATTTATTTTAGTTGATTGGATGCAAAGATAATGCATGAAATTTTA
TTTAAAAAGAGAAACCACACACAAAGCAATTTACTACTTTGATTTATATTTTACAAAAAT
ACAAAACATCAAAGAAGATAGATATTACATAATAGCTATTGCTTGCATCTTCATAGCTTC
TAAATAAGAGGTAAATTTAATTTATTTATTTTTTTTAAATTAAACAATTAATAAAATAAG
GAAATATATCCTCCCTCTTTGAATGATATTCTTTCTGGTTCACAGTATGCATCTTAAAAA
AATTTAATAAGCCAACAAGAAATTGAAATAATCAAAGTAAGTTTTTTTTAGCATTCATTT
TATTTATAATTTATAAATAAATAGTGTCTTAAGTGGAAACTCAATCCCATAACTGCTTGC
TATTGGATGGATTTGGCTATGGCACAATGGGATAGTATTCAATAGGTATAAAGTAAATCT
TGTATTTTCTTTAGAAAAAGAGATGAGCAATCCTATAAAAGATACAGAGAGGCTTACTAA
TTTTTAGATTTTATTATTCTTGATTCAAACAAAATGAAATATTCTTTGAGATTAATCACT
ATCACTTCAATATATTTAGTTATTTGTAAATACTATGCTATTAATCCTGAATAGCCAAAT
AACTAAATTGACTAAATATTTTAATAACAGAGCTATTTATAAATGTTTTAATTAAATATT
AATCTAATTAAGTAGTGTTCTAAGGAATTAAATAGTTTCTTTACAAGTTTGGCTTACGAC
TTTGATTACCCAAATGCTATTAAATAAAATAATTTTAACTAGGTAAATCTTTTAGATATT
TTTAATTTATAATAATATATTTTTATTTAAAAAAAATAATAGAAAAGTTATGAAGAATTT
TTATCTTTTTAGTCATACAGTTAACTTAACAAATAAAATTTAGAAAGTTTACTAAAATAA
AATTAAAAATTTAATTTATGA