Identifiers and Description

Gene Model Identifier

TTHERM_00784350

Standard Name

CYC21 (CYClin 21)

Aliases

PreTt25539 | 131.m00112 | 3813.m01615

Description

CYC21 amine-terminal domain cyclin; Cyclin- N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00784350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11420.29.997093137033517e-262cyclin domain-containing prote
in (1232 aa)
OxytrichaContig537.1.g1369.99893167504554e-35Cyclin
DictyBaseDDB_G02776679.001422350855153e-28DDB_G0277667 on chromosome: 2
position 8286817 to 8288311
WormBaseWBGene000226979.997975313387782e-28locus:cyy-1 Uncharacterized
cyclin-like protein ZK353.1
status:Partially_confirmed U
niProt:P34624 protein_id:CCD
73200.1
Stentor CoeruleusSteCoe_114707.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00784350(coding)
ATGAAGAGGTGGGAGGAATAGCAAAAGAATAAAGTTCATCAATCTCGTATTAAAAACGTT
AAAGCTGCTGTTTCAAATACAGGAGTACGCAAATCAGGAAAACTCAATAAATCTTTAAAT
GATTCTAAACAAATATCGTAAATTAAGAGTCCTGCATAATAAGGTGTAGCCTACGAAAAT
TAAAATTCAATAAGCGACTACTATGAATCCGAAAAAAATAATTTAGAATCTATACCATTG
TACAGAATTTTAAAGCTCTAAAATTTACAGCGATATGCCAAGGAGTTAGTATCAAGAGGT
TATGGCTATGATTTGAAGAAATTTAATTACTTAAGTTAAAATTAGCTAAACAGCCTTCTT
GATGAAATAAGAGTTTAACCTGGACATAAGACAAAATTAATTGATTTATTAGATTTAATA
TCGAATGAGATGATCCCAGAAATAGAGAATAATTCTATGTGGAATGCATTATCTCCTGGT
AGCTAAGCATAAAATTATAATTAGACTCTTTAATCAAGTGGAAAATCTATGAGTAAGGCA
AATTCTGCGAAGTAAATTCCTTCTAAGTAGCATTTTTATGCTCTAGGAAAGTAGCCTGCA
ACAACTAAAAATTAAAGGTAGTAGAATATTGTTCCTAATTTGCAAAGAAAAAACTCATAG
CCTCATGTATCCACATAGAACAGAGCAAATCACCATATGTATTATCAAGGAAATTAAAGA
TAAATAAAATCTCATACTTCTCATGTAAAGAAGCGCACAGGATAAAACATTGGATATGAT
TATTTTATAGACAGCTAAGATGGCAATGATGGATATGATGAATTTTAAGAAGCTATTGAA
AGTTTAGTCAATTAGTATAATTTTGCTAATAATCGTTAAATATTTAAAGAAAATAAATAG
ACTGATGAGTCCTTTAAGAACGAATTACAAGAGTTAGATTTAGAGTTTGAATTGGAGTAA
AATATTGGATACAGAAATTAGGCGCAAATGCGTGCTAAGGTTGATAAAGCAGTCAACTAA
GTAAATAAATCATATTCTAAAACTCAAAGTAACTATGGTAGTGGAAATTCAATCACAAGT
AATTCAACTTCTACTAAAAATCCTTCTCTAAATAATTCTAAGACAAATCAAACCAGCTCA
ACAATAAGTGGAAGCTCAATAGCATAAAAATCTGTTAACAGTACTTAAATAAACAATTCA
AAATAATAAACAAGCTCAATCACATAGACAAAACCATAAAGTTCATAGACATAAAAAAGA
CCTAACAGTGGAACGTAAAAAGCTCAAAGTATTAGCTAAACTTAATCTTCAAGAGAATCT
AATGAGTCCTATCATTAAAGAGCAGTTAGTAATATATAAACTGGGTCTGCTAAATTAACA
GATAAAGATACTCTTAAAGGTAGTAAAAAAGACAGTTAAATTATTAGTCTTCCAACTAAA
AAGTAGGAAGAAGAAAAATCTAAGCTTTAGTAAAAAGAAAAAGAATTAGATTTTAAGTAA
AAGTAGGAAATTGAGAAACTTAAATAAAAGTCAGATGGAGGTAGCAAAACCCTTGCTTAA
ACTGCTAAGGATTTAGCAAGTTAACTTTAGCATAATGATTAGCCATAATAAAATTAGAGT
GGAATTCACAAGAAAGGAAGACCCCAAACTGCAAAATATTCAAGAAATGTACCTTATGTT
CAAGATGACTAGTGCTTAATTGTAGAATATGATGAAAATGATCAATTAGTTTTAAATTAT
AAAGAAAACCGTTTGATAAAAAGTATTATGAAAAACATCAAGAGCAAAAATAATGATAAC
AGCGATGAGTTAAATCCATAGTTAGATTATGATACTATTAAGCATATGTATATGTCCTTT
GATGGTGGAAAATTGACTTCAACTTTAGTAAATTTAGATATAGAAGAAATGTGCTTCTGC
TTTGCATGTGCTATTTTAAAGCATATAGAGCATGGTGAGGAAGCTGAAAGGGCATTTCAA
AATAATAAGATGTATAATAATTTACACTAAATTGATGAAGAGCATGAAGACCATATTAGT
AAAGAATAAAATTCCTCAAAGAAAATGAACAAGCAAGACATTTCCATGGATAACTCTACA
AGTCTTCATGATACTTCTGTTCAGTCAAATGCTAACAATACCACTTCTAACAATAATTAG
TCTTAATAAAATAATCAAAATTAGCATATTATGTAACATTAATATAATGATACTTCTCTC
AATCGAACAACTAATCCTATTGAAGAACCCACGATGATTCATGATGATTATAATTAAAGC
ATCATTAACGCTGATGCAGAGAAATATTTAAAAGACGATGATTAAGACTATAGATCAGCA
GAAAGATAATTCCCACAATAGATGAGTATAAATAATGGGACTTTTAATTGGAAACAGAAA
AAGAGTCTGTCTGATATCAGTGAAAGAACTCATGAAGTTTCTCATTAAAACAATAAATCG
ATTACAGTGGACTAATCCAACGAGTAATCAGTAAACTAGAGAAATAATTTAACTAATCTA
AACAGTAGAAAGTAATTTGAATAAAGTCGCTAGGAAATGGAAGAAATTTTGAAAGAATCC
CTACTAATGAATGTGCGTGATAACTAAAGTTTACGTCGCAGACTAGAAGTCGAACACCAT
GATGACGAAAAAGAATTTGAATACACAGAAAACGAAGAAGATGATGAGGATGAATCGAAC
TAGGATATGCATTCAAATCTTAAGAGGAAAGGTTTTAAAAATATAAAATAAGAAGTTGGA
AATTCTAAGGTCCCTTACGATGAATCTCTTAACTTATATTTGGAGAAGAATCCAAATAGT
GAAGATGAAGAAAATGAATTTTTGTCATAGAATATTAACAAAGAGAGCAGCCAAAAGGTG
AAAAATAATAAATATGATTTAGACGATACATAAAATTAAGAAAAAAGCCTATAAGAACCA
GAGTCATTTAACTAGGATTACAACCAAGAAAACTATGAAGAAGTGGAGAGTGAAGGTGAA
ATAGAGGCTGATAATGAGTAGCAGGAAGTACCTAATAATCAGGAACCTGCTGAAACTGAC
AGCTAGTTGAATTTCTCTACGATATCTAGGTATTCAATGGTCATACCAAATGACGACATT
TCAAACAAGAGATTATTTGATAAGACTTACAATTATAAAGAAAATAGTGATTAAATATTC
ACTTAAAAGCCAACAAAAGAAACTATACAAAATTACTGCAAAAATGTATGCATTTCTTGC
TAATTAGAGAAGCAGATTCCTATAATAGCTCTTGTTTACATCGAAAGGCTTTTAAATAAT
AGTGGTTTTTACATGACCCCTAAAAATTGGAGAAAAGTGACAATAACTTCTATGATAATG
GCTTCCAAAATTTGGGATGATGAGTCTTTTGAAAATAAAAACTTTTCACAGGCATTCCCT
ATGTTTGATGTGATATAAATCAACGAAATGGAAAGAGTCTTTTTGAATTTTATTGACTAC
AATCTATACGTTAAAGGAGCCGATTATGCAAAATATTATTTTATATTGAGAGAATTTGCA
TAAAAAAACAAAAAGTCATTCCCATTGAGACCTTTAGATTTGAAAACTATTTTATACTTG
CAAAATAATGCAAACAGAGCTCAAAGTAACCTAAAAGAAATGTATTAAAACCCTTTAAAC
AAGAGCTTTTGA


>TTHERM_00784350(protein)
MKRWEEQQKNKVHQSRIKNVKAAVSNTGVRKSGKLNKSLNDSKQISQIKSPAQQGVAYEN
QNSISDYYESEKNNLESIPLYRILKLQNLQRYAKELVSRGYGYDLKKFNYLSQNQLNSLL
DEIRVQPGHKTKLIDLLDLISNEMIPEIENNSMWNALSPGSQAQNYNQTLQSSGKSMSKA
NSAKQIPSKQHFYALGKQPATTKNQRQQNIVPNLQRKNSQPHVSTQNRANHHMYYQGNQR
QIKSHTSHVKKRTGQNIGYDYFIDSQDGNDGYDEFQEAIESLVNQYNFANNRQIFKENKQ
TDESFKNELQELDLEFELEQNIGYRNQAQMRAKVDKAVNQVNKSYSKTQSNYGSGNSITS
NSTSTKNPSLNNSKTNQTSSTISGSSIAQKSVNSTQINNSKQQTSSITQTKPQSSQTQKR
PNSGTQKAQSISQTQSSRESNESYHQRAVSNIQTGSAKLTDKDTLKGSKKDSQIISLPTK
KQEEEKSKLQQKEKELDFKQKQEIEKLKQKSDGGSKTLAQTAKDLASQLQHNDQPQQNQS
GIHKKGRPQTAKYSRNVPYVQDDQCLIVEYDENDQLVLNYKENRLIKSIMKNIKSKNNDN
SDELNPQLDYDTIKHMYMSFDGGKLTSTLVNLDIEEMCFCFACAILKHIEHGEEAERAFQ
NNKMYNNLHQIDEEHEDHISKEQNSSKKMNKQDISMDNSTSLHDTSVQSNANNTTSNNNQ
SQQNNQNQHIMQHQYNDTSLNRTTNPIEEPTMIHDDYNQSIINADAEKYLKDDDQDYRSA
ERQFPQQMSINNGTFNWKQKKSLSDISERTHEVSHQNNKSITVDQSNEQSVNQRNNLTNL
NSRKQFEQSRQEMEEILKESLLMNVRDNQSLRRRLEVEHHDDEKEFEYTENEEDDEDESN
QDMHSNLKRKGFKNIKQEVGNSKVPYDESLNLYLEKNPNSEDEENEFLSQNINKESSQKV
KNNKYDLDDTQNQEKSLQEPESFNQDYNQENYEEVESEGEIEADNEQQEVPNNQEPAETD
SQLNFSTISRYSMVIPNDDISNKRLFDKTYNYKENSDQIFTQKPTKETIQNYCKNVCISC
QLEKQIPIIALVYIERLLNNSGFYMTPKNWRKVTITSMIMASKIWDDESFENKNFSQAFP
MFDVIQINEMERVFLNFIDYNLYVKGADYAKYYFILREFAQKNKKSFPLRPLDLKTILYL
QNNANRAQSNLKEMYQNPLNKSF


>TTHERM_00784350(gene)
ATGAAGAGGTGGGAGGAATAGCAAAAGAATAAAGTTCATCAATCTCGTATTAAAAACGTT
AAAGCTGCTGTTTCAAATACAGGAGTACGCAAATCAGGAAAACTCAATAAATCTTTAAAT
GATTCTAAACAAATATCGTAAATTAAGAGTCCTGCATAATAAGGTGTAGCCTACGAAAAT
TAAAATTCAATAAGCGACTACTATGAATCCGAAAAAAATAATTTAGAATCTATACCATTG
TACAGAATTTTAAAGCTCTAAAATTTACAGCGATATGCCAAGGAGTTAGTATCAAGAGGT
TATGGCTATGATTTGAAGAAATTTAATTACTTAAGTTAAAATTAGCTAAACAGCCTTCTT
GATGAAATAAGAGTAAGAAAATACAAATAAAAAAGAATCATTAATTAATTACACTTGATT
TTAAACTAGGATTAAAAATAATTTTTTTAAAAATTCAAGGTTTAACCTGGACATAAGACA
AAATTAATTGATTTATTAGATTTAATATCGAATGAGATGATCCCAGAAATAGAGAATAAT
TCTATGTGGAATGCATTATCTCCTGGTAGCTAAGCATAAAATTATAATTAGACTCTTTAA
TCAAGTGGAAAATCTATGAGTAAGGCAAATTCTGCGAAGTAAATTCCTTCTAAGTAGCAT
TTTTATGCTCTAGGAAAGTAGCCTGCAACAACTAAAAATTAAAGGTAGTAGAATATTGTT
CCTAATTTGCAAAGAAAAAACTCATAGCCTCATGTATCCACATAGAACAGAGCAAATCAC
CATATGTATTATCAAGGAAATTAAAGATAAATAAAATCTCATACTTCTCATGTAAAGAAG
CGCACAGGATAAAACATTGGATATGATTATTTTATAGACAGCTAAGATGGCAATGATGGA
TATGATGAATTTTAAGAAGCTATTGAAAGTTTAGTCAATTAGTATAATTTTGCTAATAAT
CGTTAAATATTTAAAGAAAATAAATAGACTGATGAGTCCTTTAAGAACGTAAAAAGAAAA
GATTAATGAATATGCAATATATATTTAAATTTTAATTTATTTTATTAGGAATTACAAGAG
TTAGATTTAGAGTTTGAATTGGAGTAAAATATTGGATACAGAAATTAGGCGCAAATGCGT
GCTAAGGTTGATAAAGCAGTCAACTAAGTAAATAAATCATATTCTAAAACTCAAAGTAAC
TATGGTAGTGGAAATTCAATCACAAGTAATTCAACTTCTACTAAAAATCCTTCTCTAAAT
AATTCTAAGACAAATCAAACCAGCTCAACAATAAGTGGAAGCTCAATAGCATAAAAATCT
GTTAACAGTACTTAAATAAACAATTCAAAATAATAAACAAGCTCAATCACATGTAATCAT
ATTCAAATTTTTAAAAAATATATGTATTTATTAATAAATATTATTAAATTTAAGAGACAA
AACCATAAAGTTCATAGACATAAAAAAGACCTAACAGTGGAACGTAAAAAGCTCAAAGTA
TTAGCTAAACTTAATCTTCAAGAGAATCTAATGAGTCCTATCATTAAAGAGCAGTTAGTA
ATATATAAACTGGGTCTGCTAAATTAACAGATAAAGATACTCTTAAAGGTAGTAAAAAAG
ACAGTTAAATTATTAGTCTTCCAACTAAAAAGTAGGAAGAAGAAAAATCTAAGCTTTAGT
AAAAAGAAAAAGAATTAGATTTTAAGTAAAAGTAGGAAATTGAGAAACTTAAATAAAAGT
CAGATGGAGGTAGCAAAACCCTTGCTTAAACTGCTAAGGATTTAGCAAGTTAACTTTAGC
ATAATGATTAGCCATAATAAAATTAGAGTGGAATTCACAAGAAAGGAAGACCCCAAACTG
CAAAATATTCAAGAAATGTACCTTATGTTCAAGATGACTAGTGCTTAATTGTAGAATATG
ATGAAAATGATCAATTAGTTTTAAATTATAAAGAAAACCGTTTGATAAAAAGTATTATGA
AAAACATCAAGAGCAAAAATAATGTATTAATAAAATCAAAGAAAACTTGATTTTGATTGA
GTAATTTTTTATCTTTTTTAAAAAATATAGGATAACAGCGATGAGTTAAATCCATAGTTA
GATTATGATACTATTAAGCATATGTATATGTCCTTTGATGGTGGAAAATTGACTTCAACT
TTAGTAAATTTAGATATAGAAGAAATGTGCTTCTGCTTTGCATGTGCTATTTTAAAGCAT
ATAGAGCATGGTGAGGAAGCTGAAAGGGCATTTCAAAATAATAAGATGTATAATAATTTA
CACTAAATTGATGAAGAGCATGAAGACCATATTAGTAAAGAATAAAATTCCTCAAAGAAA
ATGAACAAGCAAGACATTTCCATGGATAACTCTACAAGTCTTCATGATACTTCTGTTCAG
TCAAATGCTAACAATACCACTTCTAACAATAATTAGTCTTAATAAAATAATCAAAATTAG
CATATTATGTAACATTAATATAATGATACTTCTCTCAATCGAACAACTAATCCTATTGAA
GAACCCACGATGATTCATGTATTTACTTTTTTAAATAAAGCAACTCATTTAATAAATTAG
TTAACTAATTTTTAAAAAATGATTAATAGGATGATTATAATTAAAGCATCATTAACGCTG
ATGCAGAGAAATATTTAAAAGACGATGATTAAGACTATAGATCAGCAGAAAGATAATTCC
CACAATAGATGAGTATAAATAATGGGACTTTTAATTGGAAACAGAAAAAGAGTCTGTCTG
ATATCAGTGAAAGAACTCATGAAGTTTCTCATTAAAACAATAAATCGATTACAGTGGACT
AATCCAACGAGTAATCAGTAAACTAGAGAAATAATTTAACTAATCTAAACAGTAGAAAGT
AATTTGAATAAAGTCGCTAGGAAATGGAAGAAATTTTGAAAGAATCCCTACTAATGAATG
TGCGTGATAACTAAAGTTTACGTCGCAGACTAGAAGTCGAACACCATGATGACGAAAAAG
AATTTGAATACACAGAAAACGAAGAAGATGATGAGGATGAATCGAACTAGGATATGCATT
CAAATCTTAAGAGGAAAGGTTTTAAAAATATAAAATAAGAAGTTGGAAATTCTAAGGTCC
CTTACGATGAATCTCTTAACTTATATTTGGAGAAGAATCCAAATAGTGAAGATGAAGAAA
ATGAATTTTTGTCATAGAATATTAACAAAGAGAGCAGCCAAAAGGTGAAAAATAATAAAT
ATGATTTAGACGATACATAAAATTAAGAAAAAAGCCTATAAGAACCAGAGTCATTTAACT
AGGATTACAACCAAGAAAACTATGAAGAAGTGGAGAGTGAAGGTGAAATAGAGGCTGATA
ATGAGTAGCAGGAAGTACCTAATAATCAGGAACCTGCTGAAACTGACAGCTAGTTGAATT
TCTCTACGATATCTAGGTATTCAATGGTCATACCAAATGACGACATTTCAAACAAGAGAT
TATTTGATAAGACTTACAATTATAAAGAAAATAGTGATTAAATATTCACTTAAAAGCCAA
CAAAAGAAACTATACAAAATTACTGCAAAAATGTATGCATTTCTTGCTAATTAGAGAAGC
AGATTCCTATAATAGCTCTTGTTTACATCGAAAGGCTTTTAAATAATAGTGGTTTTTACA
TGACCCCTAAAAATTGGAGAAAAGTGACAATAACTTCTATGATAATGGCTTCCAAAATTT
GGGATGATGAGTCTTTTGAAAATAAAAACTTTTCACAGGCATTCCCTATGTTTGATGTGA
TATAAATCAACGAAATGGAAAGAGTCTTTTTGAATTTTATTGACTACAATCTATACGTTA
AAGGAGCCGATTATGCAAAATATTATTTTATATTGAGAGAATTTGCATAAAAAAACAAAA
AGTCATTCCCATTGAGACCTTTAGATTTGAAAACTATTTTATACTTGCAAAATAATGCAA
ACAGAGCTCAAAGTAACCTAAAAGAAATGTATTAAAACCCTTTAAACAAGAGCTTTTGA