Identifiers and Description

Gene Model Identifier

TTHERM_00624450

Standard Name

CYC20 (CYClin)

Aliases

PreTt07433 | 87.m00213 | 3814.m00914

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00624450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12023.19.997093137033517e-262hypothetical protein (2354 aa)
OxytrichaContig14167.0.g672.000704504372864e-47Cyclin, N-terminal domain
WormBaseWBGene000008638.998359040303252e-24locus:cya-1 G2/mitotic-speci
fic cyclin-A1 status:Confirm
ed UniProt:P34638 protein_
id:CAA82372.1
Stentor CoeruleusSteCoe_237757.095474162284704e-23
SGDYDL155W3.0007793728221555e-22CLB3 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the G2/
M transition; may be involved
in DNA replication and spindle
assembly; accumulates during
S phase and G2, then targeted
for ubiquitin-mediated degrada
tion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00624450(coding)
ATGTATTTTGAAGACTAGAAGAAACAAGGTCGAAACAGATCATTTGCATAGGTAGAGAAT
TTTTCTAACAAGAATAAAGTTTGTTAGAATCCTACATAGCATTAAGGCCAAACCAAGTAG
ATTCAAAGTACATCTAATAAAGGTACTTAAGATAATCAAAGCTATAACCAGAATCATTTT
CATTAAGATTAACCTGCTTTTTCTGTTCCTTCTCATCCGTAGTATTCTTCTTCAGTTTCC
TAAAATATGCAAATTAACGTAAAAGGTCAAAACCTCAATCACCATAGTTCTATGAGCCTT
TAGAATAACTAGGGAGTTTATAAATACAGCGGCTCTTAAAATTTTTAAAGCAGCTAATTA
AATAATCCCCAAAGCTTCCAATAAATTTAGCAAAATCCTTCTTAGTCTTAAAAATCTTAG
CCCTAAGCCACAGATACTTAGAAAATATTACAAGAATAGCATATTAATACGCATTAAAAT
AAGCTTTAGATGTAAAGCTCAAATTGTGCTCTTAGTAAAGCAGCCTAATTGAAGACTTCA
AATTCAGCATAATAAAGTGCATAGAACATGTTAGGCACAAATTCAATTAATTCATAAAAT
TGTAGCAATTAATTCACTAAAAATTCATCATACTGTCAAGAAATTAATTAGCACAATAAT
GTTAAAAAAAGTGTTTAAGTGAATATCAAAAGTAAATAAAAACCGGAGAATGATCAATTA
GATAATTCAAATATACCTCAGTAATAAATATCATTATAGTAAACAGTTCATTCTAATTTA
CTTCCTTATGCTTAAAACGGGGAATATGCACTTTAGTAGACCAATACTTCAAGCAGTACT
AATTAATAACAACTAATGAACCAGTAGTATGCAACTAAGACAAAAAAGCATCAACGCCAC
CACTCAGAAATAGCTATTTCAAAGCATTCTAAGTAATACAGCATACTAGGAGTAAATCTG
CAACCTCCACCTTAGATGTCTATTCATAACTATTAAGGTTTTTAGAAGGAGTCCTATAAT
AAAGAAAATCTAAATATTTATGATACTGCAATTTCTAGTAACCGCTACAATGTTAATGAG
TAAAATTTGATTTAGGCTAAACCTAAAGGAATATCACCCCATAATACTGATAGCTATAAG
AAACTAGAGTATAAAAATGACCAAGTTACAAATTAAAACTAAAATCAATAAGGTTAATAA
TTATATAACGAAAAAAATTTTAATTCTTCTTCTTTACGCTTTACAGCTAATAATCCAAGC
TGCATAATGAGTATAAATGATGGGAATACCTCGTCAAATAACTAAAAAATCGAATAGGGA
ATATAGAAAGAAGTAATTAATAGCTACATTTCGTTGAGATTAAAAAATTCAAGATAAAAT
TCAATAAGCATTCTACCAACTCACGATTAATTTAAATAAAATGCCACTGAACATAATTAG
ATCGATGATAAAAATAAAAATTCAAGCAGGTAGTACAAAGAAACAAAGATAGGTATGATA
AGTGATGAGAATAATAGTATAAACTATAGACAACAAAATGTAGAGTCATTGAAAACAAAA
ATGAGTCCCATAATTTAACCTCAAAAGTAAAATGATTAAAAGTTAGCTAAGCTAAAAGAC
TAAGATAAATATCAAAATGCGTCTTTAAAAGTAGATTAATAAGATATTAATTCTACCTTG
AAAGGAGATAATATTATGAAAAATAATAAATTTCAAAATTACTCTATATTAGCTGATGAA
ATTCAGTAAAACTTGAACTTATAGAATCGAAGAGTTTCTGCCCTTCTTAATAATGATAAT
ACCTAGAATTATTTGAATTTAACTGAAAATTAAAGCTATTAAAGCACGAATAGAAGTTTA
AATAATAAACATACTTCTATAAATACTAATTACGATTAATAGCCTTGTAATGCAAACATA
TATAGCGTTCCATCAAATAATAGCAGTGTTATTAATAAATCTAACTCCACTTCGTTTCAT
CAAAGTAATCTACAATAAGGATAACAATAAAAAGAGTTAGTTAATACTTTCACTAATATT
AATAATGGATAAGGTTCATAATAAAATTCAACTACTAATTTGTCATATAATCACTCTATT
AATAATAATTAATATTAAACAAGCTCAAACTAAACTTCTATCATGCATAATTCCATTAGC
CAAGCAAACCCTTCCTTCTAAACCAGAGCAAATAATAAGAATGATTCATAGACTAACGAG
AATAATTTTTAAATACAGTAAAATATTAGTTTGAATAGTAAAATATAAAATATTCTGTCT
CATGAGACAAAAAGTAACTTAGTGAGTAAAAATACTACAATATAGTATAATAACCCATTA
AATCCTAACAACTAAGGATAATCACTATCCTCTCATCCTACTTATAGAGAGAAAGAATTT
AACATTGTGTAAGATTATAATCCAAAATCAATGATTGAAAAGCGTAGAAAATCTCATAGC
ATAGCCAATAACATTATTAATAGTAATTCCCGCAATTTAAAACAAGCAATAATTTAATCA
ACCTTATAGTAAGCTTAAGCATAAGAATTATCTTAGAATAATTCTCATTTACAAAGCACA
AATTCGATGATTAACTAAAATTTACCCTAGAATAGCTCTTAGATTATAAGTTATAATAAC
TAAAATTTCAGTTAATAAACTACAACAAATAAATCTAATTCTAATAATCCAATTAAAACT
TAAAATGGCCAATAGAATTTACAAACTAACATGATTTTATAGAACGTATCTTAAATAGGA
AATAATTTTGGATTAGCTCCTTCTAGTTAACATACTCCAACAAGTATTAGTCCTATAAAT
TACATGCAAAGCTAAAGTAATTATAGCAGTAATAGTAATTTAAATAATGGATGTAGTAGT
GGATCAAAGTAAAATATCTGTAATTAGCAACCTATCTTAAATTAGGCTAATGTTAGTTCA
GGTACTTAAGATTAATCAAAATTAAGTGTAAATAAAGTGAATCTAACATTTGCAGAACAA
TTAAAAATTGAAAAACAAAAGAAACTGAAAGAACCAACTCTCAATATATTAAATTTAGGC
ATAAACAGTGAAAGAAATAGCAAATAAAATTTTGTTTCTAATACAGCAAATAACAGCTAT
AGTTACTGCAGCAATAACAGCAACAATACTTCAGCTATAAGTACTCCTTATGCTATTACA
AATGCTGTAGATACCACACAGAAGAGCAATATCATTTCTAATAACACAATAAATTCTAAT
AATAAAGCCAATAAAAATAGTTATGTAAACGAGCCAATGATTTACTCAGGTAAAAATTCA
AACAGCTCGAGTCTATAAAACACATATGTTAAAAACAATAACGAATTTTAATAGAGTTAT
ACCAAACCATATGATAACTATACAAACCCTAACTCAAATAGAGTTAATTTACCTTCAAAT
TCCATTCATACAAATTAAGAACCATATAGTAGAGAAATGCAATAAATAAATGAACTTTTA
TAATAAGCAAAATATATAGCACCATCCAACACATCTAATGATTCAAAATATTATACACTT
TAATACAATAAATTAAATAATTTTGAATCTGACTTCTTATTACCAACCAGTGCACCTGCA
TAGTAAATAAATAGTCTTGCATTCAAAGATTTGGTTAATTAAAAACCTAATGACATACCA
TAAATTACAAGGACAAATAGTATAATCAGCAATAAAAAGAGTAGCCCTTCAATTATAGAT
TAGCAAAATATAAATCAATTAAAGCAAACAGCTAAACCTTGCATAAATAATACTAAATCA
GGAGAATATGATTTAATTCAATAGAGCTTAACTATAAATAAAGAGTAAGAATATTCTAGT
AACAGCTTAAAAGAAAAGGCTTAACAACCTTAGCTATCAGGAAAGTAATTGATACTTAAT
AATAATATTTCAAATAATAGTTCAATTAACCAAGAAAAAATATTTTCTACAGGTGAAATC
ATCTAATAATATGACAGCAGTAAAAATCTAAGCTAAAATCAAATCAATAAAATTAAAAAT
GAGCAAATTAGTTAAATAAATATTGACAAAAATTTTAATGAAAAACCATCTCAAAATGAT
AAAAAATAATAAATGTAGAATGTCAAATCAATCTAGCAATAATAATAGTAGTGTTAGCAA
CCTGTAAAGTGGTACCTCTATGATTCATAGGCCTAGTTTGAAGAGCAAGATAATCTTAAT
AATTTTAATAGTTATGGAATGCAGCAAAAATAGTAAGTTGCTAAAACTAAAGACCAAATA
TATCAAAAGTAAAATAAAGCAAACGTTACAGAAACTTTCCCTGATAATAAGCATTTTTTA
AATTCAGAATCTTCTAGTTTAACTCAAATATCAACCTACAGAGAAGAGAGTTCTAAGTGC
ATTACAAATGATTCATAATTTAATAATTTCAATAATCATTAAGGAAAATAGGTAAATGAT
ATTTAATATTAGGAATTCAATTACTAGGGTTAATTATAAAGCACAAAACAAGCAAAAGAT
TTTACAATTAAAGAAACAAACATGAATTAGCCTTATCAGCTTTGCTAAAAAACAACAAAT
ACTAATACAAAATTAGAAAACTGCTCAATCCTTAATAATATAAACGAAATAAAAGATTCA
TATCATATGGATTTTGAAGATCTTGCAAAATATTTTAGTTAAAATAACGGAACAAAGCCT
TCTAATAACACTCCATCATCAGAAAAACAAAAATAAATTTAATCTCAGTTAAAATTAGAA
AGCGAAGAGTACAAAAATTTGTGTTCATCAATAGAATCTCTTCGTCTTCTAAATACAAAA
GATGATCCCTTTATAAAAATTCAAAACCAAGAAGATTTCTCGGAAATTTAAAAATTAGCT
TTAAAAGGCAGCACTACTGATGATAACTTTAGCAACACGAATAAAAATTCAATTATTTAT
AAAAATAGAGAGAAATTACAAGATGATATTTCTGAAGCTATAGAATCAGATAGTAGTTTA
AATAAAATTAAGAGTTAGTAAAACCATTTTATAGATGAACCATATTCTATCAACCAGCAA
GAGTTTTATAGTTAATCTAATTTAAATTTGAAATAAAAAAATTTGAATGGTTTTGAAGGT
CTTTATTCAATAGAGGAGGGTGAGTATGAGTTAAAATCTAACCCATATTATGATTAAGAT
TCTTAAAATAGCTCTTAATTTAGCTTAAAGGCTGTAGAAGAAGAGTTAGATGATGAAGAA
AAATCACAAAGATTAAAATAAAGTTCATAAAATAACTCATAGGAAAGTATAAACTCAAAT
AAATAATCAGATTCATAAGAAAAAGCTAATATTTCTTAGCAGTTGAAAGAAAAAGAGGAA
GAAGAAAGTATAGAAGATCCTCAACTCATGTGTGATGAGGAATAAATTTATGAAATGATG
AATAGCAATATTTCTAATATCCTTGACCAAATAAATAATGACGATCCAAACCAAGCCTTC
TACTCTAATAATTACTATGATTAACCATGCTTTAATATTGAGTCATACAGCAATTTTAAA
ATAATTCCTTAGTCTTACAGCAATGCTCCCTCTAATTAAAAATAAGAAAATGAAACAAAT
TACTCTTCAAACCCAATGGTTGCTCCTTTTGTAGATGTGCCTTAATACGATCAAAAGTAT
CATAATAGCTAGAATAAGAATCTTTCAGAGATTGCAAGCAAGTCACATAATATAGATCCT
AAGGAAAACTAAAAAGAAAATTAAAAGAAAGTAGAGAGTAAATAACTGGAAAAAGATGAA
AAACCTGTTTAAGAGGAAAACTAGAAAAAAGCTAATAAATCTATCAGCGCTTTAGGAACC
AATCATTAAATTTAATAGAAAAAAACAGAAGAGAACTTATCTAAAGAATAAAAATTAGCT
TTATTGAAAGAATAACTAGCAAACTTTGATAAAATATAAAACTAGTTCCCTATTTTCGGA
GGAGAACATCTTGCCTACCTACTCTCTAGAGAATCAGATTATTAACCAAATCCGTTTTAT
ATGAAGCATTAGAGGTAATTCAGTCCAAACATGAGAGCAATTCTATTGGATTGGATGATG
GAAGTTAGTGAAGAGTTTGGCTTAAAAAGAGAAACTTATTACATTGCTGTAAACTTAGTG
GACAGAATGTTTTCTTGTAAACATAATTTACAAATAAAAGAATTTTAGTTGATTGGTGTT
ACTTCTCTACATATTGCTTCTAAATTAGAGGAAATTTATCCAAAAAGAGTGGAATAATTT
ATTTTATCAACTGATAATGGATATACAGCACAACTAGTCTTTGAAACTGAAAAAAATATA
TTATAGAAACTTAATTTTATGGTAAATCCTCCTACGGTTTCGTTCTGGGGTAACTGGTTC
ATGTCTTAATGGGATATTTTTATTCAAACTTCTGAAAAAGCATAAAATAGTAAATTAGTC
CTATAATTTTATGAAAACAATAGCTGCTTTGTGCAGTTTAGATAAGCTACCAACTAGTCC
TATGAGTTGTTTAGAGAATACATGTAAATTATGGACTTCTCTATTTTAGATGTACAAACT
CTCTAAATAAGTGCTACCAAATTACACTGCAGTATTATGTATCTTGTTTTAGGAAAAGCT
CATGGAGTATACACTTTAGATGACATATAAAATGAGGTAGCATAAGGATTCATTTTTACA
AAAAAAGCCTAGGATTTCAACGATATTTACAATGAATTTGCAAGTGTTTCATTTGGAATA
AATATTTAAAATATTGTCACTTGCATTTAATATATCTCAAAGTTCTTTGTACTACCTGTG
ACCAATGCTTTACCATTTATTATCTCTGAAATGAAAGAGCCTCTTCAAGGAAATTATGAA
GATTTTCTTTAATACTAAACTCATAATAAAAATTAAATAGAAAAAATAAAAAACATAATT
TAAAAAGTGTATAAAATAAATGGATGA


>TTHERM_00624450(protein)
MYFEDQKKQGRNRSFAQVENFSNKNKVCQNPTQHQGQTKQIQSTSNKGTQDNQSYNQNHF
HQDQPAFSVPSHPQYSSSVSQNMQINVKGQNLNHHSSMSLQNNQGVYKYSGSQNFQSSQL
NNPQSFQQIQQNPSQSQKSQPQATDTQKILQEQHINTHQNKLQMQSSNCALSKAAQLKTS
NSAQQSAQNMLGTNSINSQNCSNQFTKNSSYCQEINQHNNVKKSVQVNIKSKQKPENDQL
DNSNIPQQQISLQQTVHSNLLPYAQNGEYALQQTNTSSSTNQQQLMNQQYATKTKKHQRH
HSEIAISKHSKQYSILGVNLQPPPQMSIHNYQGFQKESYNKENLNIYDTAISSNRYNVNE
QNLIQAKPKGISPHNTDSYKKLEYKNDQVTNQNQNQQGQQLYNEKNFNSSSLRFTANNPS
CIMSINDGNTSSNNQKIEQGIQKEVINSYISLRLKNSRQNSISILPTHDQFKQNATEHNQ
IDDKNKNSSRQYKETKIGMISDENNSINYRQQNVESLKTKMSPIIQPQKQNDQKLAKLKD
QDKYQNASLKVDQQDINSTLKGDNIMKNNKFQNYSILADEIQQNLNLQNRRVSALLNNDN
TQNYLNLTENQSYQSTNRSLNNKHTSINTNYDQQPCNANIYSVPSNNSSVINKSNSTSFH
QSNLQQGQQQKELVNTFTNINNGQGSQQNSTTNLSYNHSINNNQYQTSSNQTSIMHNSIS
QANPSFQTRANNKNDSQTNENNFQIQQNISLNSKIQNILSHETKSNLVSKNTTIQYNNPL
NPNNQGQSLSSHPTYREKEFNIVQDYNPKSMIEKRRKSHSIANNIINSNSRNLKQAIIQS
TLQQAQAQELSQNNSHLQSTNSMINQNLPQNSSQIISYNNQNFSQQTTTNKSNSNNPIKT
QNGQQNLQTNMILQNVSQIGNNFGLAPSSQHTPTSISPINYMQSQSNYSSNSNLNNGCSS
GSKQNICNQQPILNQANVSSGTQDQSKLSVNKVNLTFAEQLKIEKQKKLKEPTLNILNLG
INSERNSKQNFVSNTANNSYSYCSNNSNNTSAISTPYAITNAVDTTQKSNIISNNTINSN
NKANKNSYVNEPMIYSGKNSNSSSLQNTYVKNNNEFQQSYTKPYDNYTNPNSNRVNLPSN
SIHTNQEPYSREMQQINELLQQAKYIAPSNTSNDSKYYTLQYNKLNNFESDFLLPTSAPA
QQINSLAFKDLVNQKPNDIPQITRTNSIISNKKSSPSIIDQQNINQLKQTAKPCINNTKS
GEYDLIQQSLTINKEQEYSSNSLKEKAQQPQLSGKQLILNNNISNNSSINQEKIFSTGEI
IQQYDSSKNLSQNQINKIKNEQISQINIDKNFNEKPSQNDKKQQMQNVKSIQQQQQQCQQ
PVKWYLYDSQAQFEEQDNLNNFNSYGMQQKQQVAKTKDQIYQKQNKANVTETFPDNKHFL
NSESSSLTQISTYREESSKCITNDSQFNNFNNHQGKQVNDIQYQEFNYQGQLQSTKQAKD
FTIKETNMNQPYQLCQKTTNTNTKLENCSILNNINEIKDSYHMDFEDLAKYFSQNNGTKP
SNNTPSSEKQKQIQSQLKLESEEYKNLCSSIESLRLLNTKDDPFIKIQNQEDFSEIQKLA
LKGSTTDDNFSNTNKNSIIYKNREKLQDDISEAIESDSSLNKIKSQQNHFIDEPYSINQQ
EFYSQSNLNLKQKNLNGFEGLYSIEEGEYELKSNPYYDQDSQNSSQFSLKAVEEELDDEE
KSQRLKQSSQNNSQESINSNKQSDSQEKANISQQLKEKEEEESIEDPQLMCDEEQIYEMM
NSNISNILDQINNDDPNQAFYSNNYYDQPCFNIESYSNFKIIPQSYSNAPSNQKQENETN
YSSNPMVAPFVDVPQYDQKYHNSQNKNLSEIASKSHNIDPKENQKENQKKVESKQLEKDE
KPVQEENQKKANKSISALGTNHQIQQKKTEENLSKEQKLALLKEQLANFDKIQNQFPIFG
GEHLAYLLSRESDYQPNPFYMKHQRQFSPNMRAILLDWMMEVSEEFGLKRETYYIAVNLV
DRMFSCKHNLQIKEFQLIGVTSLHIASKLEEIYPKRVEQFILSTDNGYTAQLVFETEKNI
LQKLNFMVNPPTVSFWGNWFMSQWDIFIQTSEKAQNSKLVLQFYENNSCFVQFRQATNQS
YELFREYMQIMDFSILDVQTLQISATKLHCSIMYLVLGKAHGVYTLDDIQNEVAQGFIFT
KKAQDFNDIYNEFASVSFGINIQNIVTCIQYISKFFVLPVTNALPFIISEMKEPLQGNYE
DFLQYQTHNKNQIEKIKNIIQKVYKING


>TTHERM_00624450(gene)
ATGTATTTTGAAGACTAGAAGAAACAAGGTCGAAACAGATCATTTGCATAGGTAGAGAAT
TTTTCTAACAAGAATAAAGTTTGTTAGAATCCTACATAGCATTAAGGCCAAACCAAGTAG
ATTCAAAGTACATCTAATAAAGGTACTTAAGATAATCAAAGCTATAACCAGAATCATTTT
CATTAAGATTAACCTGCTTTTTCTGTTCCTTCTCATCCGTAGTATTCTTCTTCAGTTTCC
TAAAATATGCAAATTAACGTAATATTAGCTTGAAAAATTTTATTTTTAAACATATTCACA
TAGATAGCAGCATTTTTATTAAATTATTCTTAATTGTAAAGGTAAAAGGTCAAAACCTCA
ATCACCATAGTTCTATGAGCCTTTAGAATAACTAGGGAGTTTATAAATACAGCGGCTCTT
AAAATTTTTAAAGCAGCTAATTAAATAATCCCCAAAGCTTCCAATAAATTTAGCAAAATC
CTTCTTAGTCTTAAAAATCTTAGCCCTAAGCCACAGATACTTAGAAAATATTACAAGAAT
AGCATATTAATACGCATTAAAATAAGCTTTAGATGTAAAGCTCAAATTGTGCTCTTAGTA
AAGCAGCCTAATTGAAGACTTCAAATTCAGCATAATAAAGTGCATAGAACATGTTAGGCA
CAAATTCAATTAATTCATAAAATTGTAGCAATTAATTCACTAAAAATTCATCATACTGTC
AAGAAATTAATTAGCACAATAATGTTAAAAAAAGTGTTTAAGTGAATATCAAAAGTAAAT
AAAAACCGGAGAATGATCAATTAGATAATTCAAATATACCTCAGTAATAAATATCATTAT
AGTAAACAGTTCATTCTAATTTACTTCCTTATGCTTAAAACGGGGAATATGCACTTTAGT
AGACCAATACTTCAAGCAGTACTAATTAATAACAACTAATGAACCAGTAGTATGCAACTA
AGACAAAAAAGCATCAACGCCACCACTCAGAAATAGCTATTTCAAAGCATTCTAAGTAAT
ACAGCATACTAGGAGTAAATCTGCAACCTCCACCTTAGATGTCTATTCATAACTATTAAG
GTTTTTAGAAGGAGTCCTATAATAAAGAAAATCTAAATATTTATGATACTGCAATTTCTA
GTAACCGCTACAATGTTAATGAGTAAAATTTGATTTAGGCTAAACCTAAAGGAATATCAC
CCCATAATACTGATAGCTATAAGAAACTAGAGTATAAAAATGACCAAGTTACAAATTAAA
ACTAAAATCAATAAGGTTAATAATTATATAACGAAAAAAATTTTAATTCTTCTTCTTTAC
GCTTTACAGCTAATAATCCAAGCTGCATAATGAGTATAAATGATGGGAATACCTCGTCAA
ATAACTAAAAAATCGAATAGGGAATATAGAAAGAAGTAATTAATAGCTACATTTCGTTGA
GATTAAAAAATTCAAGATAAAATTCAATAAGCATTCTACCAACTCACGATTAATTTAAAT
AAAATGCCACTGAACATAATTAGATCGATGATAAAAATAAAAATTCAAGCAGGTAGTACA
AAGAAACAAAGATAGGTATGATAAGTGATGAGAATAATAGTATAAACTATAGACAACAAA
GTAAAAAATAATTTATTTAAAATTTTAATTTTTCATCTCTCAATTTAAATATTTTCAATA
AACTATAAAGACTTAGTTTTTAATCTTTGCCTTGCCTTTATTTTTCTACTTAGGATTATT
TAGAAATTAGAAAAATGTGAGTGAATTAAATCTTTAGAGTTTGAAATTAAATTTTTTATT
TCAAAATTAATCACGAATAAATAAACAAGCAAAAAAACAAAAACATCTCAAAATTAATTA
AAGATTTTTTATTAAATATCTAACAAAATTTATAAATAAATTGAATAATCCCAATTTCAA
AATTTTAACAGCAAAATTCAAAATCAATTTTTGTATTTTAAATTATCAGTTTTCTGCCTA
TTTTGCCTTTTAAGATTTTTACATTTTAATTTTGCCTCCAAATTATTGTTTAATTAATCA
ATTATTACTATCAACTATAATGAAAGCTAAATTATTTCACTAAATATTTTAAATCAACAT
TCACATTAAGCAAGCAAAGTAAATGAATTTACAATAAAAATTTCACCATTGAAAATAGAT
AAAAATATCACTTTACAAAAAAAATAATTATTATTTTTTATTATTTAATAAATCATATCA
AAATTTTGAAAAAACTAAGTATGCATCGTATTCTAAATAGACAAAAGTTCAATTAAAAAA
TTAACATTTGAGATATATAAAATATTTTAATTTTTTTAAATATATTGAATTAAATATTTT
AAAAAATAATAATAATTTTAAAAATTTATATAAATAGATGTAGAGTCATTGAAAACAAAA
ATGAGTCCCATAATTTAACCTCAAAAGGTAAATTCATTGAAACACTAATCTAAATTAATA
TTTATTTTATTTTAGTAAAATGATTAAAAGTTAGCTAAGCTAAAAGACTAAGATAAATAT
CAAAATGCGTCTTTAAAAGTAGATTAATAAGATATTAATTCTACCTTGAAAGGAGATAAT
ATTATGAAAAATAATAAATTTCAAAATTACTCTATATTAGCTGATGAAATTCAGTAAAAC
TTGAACTTATAGAATCGAAGAGTTTCTGCCCTTCTTAATAATGATAATACCTAGAATTAT
TTGAATTTAACTGAAAATTAAAGCTATTAAAGCACGAATAGAAGTTTAAATAATAAACAT
ACTTCTATAAATACTAATTACGATTAATAGCCTTGTAATGCAAACATATATAGCGTTCCA
TCAAATAATAGCAGTGTTATTAATAAATCTAACTCCACTTCGTTTCATCAAAGTAATCTA
CAATAAGGATAACAATAAAAAGAGTTAGTTAATACTTTCACTAATATTAATAATGGATAA
GGTTCATAATAAAATTCAACTACTAATTTGTCATATAATCACTCTATTAATAATAATTAA
TATTAAACAAGCTCAAACTAAACTTCTATCATGCATAATTCCATTAGCCAAGCAAACCCT
TCCTTCTAAACCAGAGCAAATAATAAGAATGATTCATAGACTAACGAGAATAATTTTTAA
ATACAGTAAAATATTAGTTTGAATAGTAAAATATAAAATATTCTGTCTCATGAGACAAAA
AGTAACTTAGTGAGTAAAAATACTACAATATAGTATAATAACCCATTAAATCCTAACAAC
TAAGGATAATCACTATCCTCTCATCCTACTTATAGAGAGAAAGAATTTAACATTGTGTAA
GATTATAATCCAAAATCAATGATTGAAAAGCGTAGAAAATCTCATAGCATAGCCAATAAC
ATTATTAATAGTAATTCCCGCAATTTAAAACAAGCAATAATTTAATCAACCTTATAGTAA
GCTTAAGCATAAGAATTATCTTAGAATAATTCTCATTTACAAAGCACAAATTCGATGATT
AACTAAAATTTACCCTAGAATAGCTCTTAGATTATAAGTTATAATAACTAAAATTTCAGT
TAATAAACTACAACAAATAAATCTAATTCTAATAATCCAATTAAAACTTAAAATGGCCAA
TAGAATTTACAAACTAACATGATTTTATAGAACGTATCTTAAATAGGAAATAATTTTGGA
TTAGCTCCTTCTAGTTAACATACTCCAACAAGTATTAGTCCTATAAATTACATGCAAAGC
TAAAGTAATTATAGCAGTAATAGTAATTTAAATAATGGATGTAGTAGTGGATCAAAGTAA
AATATCTGTAATTAGCAACCTATCTTAAATTAGGCTAATGTTAGTTCAGGTACTTAAGAT
TAATCAAAATTAAGTGTAAATAAAGTGAATCTAACATTTGCAGAACAATTAAAAATTGAA
AAACAAAAGAAACTGAAAGAACCAACTCTCAATATATTAAATTTAGGCATAAACAGTGAA
AGAAATAGCAAATAAAATTTTGTTTCTAATACAGCAAATAACAGCTATAGTTACTGCAGC
AATAACAGCAACAATACTTCAGCTATAAGTACTCCTTATGCTATTACAAATGCTGTAGAT
ACCACACAGAAGAGCAATATCATTTCTAATAACACAATAAATTCTAATAATAAAGCCAAT
AAAAATAGTTATGTAAACGAGCCAATGATTTACTCAGGTAAAAATTCAAACAGCTCGAGT
CTATAAAACACATATGTTAAAAACAATAACGAATTTTAATAGAGTTATACCAAACCATAT
GATAACTATACAAACCCTAACTCAAATAGAGTTAATTTACCTTCAAATTCCATTCATACA
AATTAAGAACCATATAGTAGAGAAATGCAATAAATAAATGAACTTTTATAATAAGCAAAA
TATATAGCACCATCCAACACATCTAATGATTCAAAATATTATACACTTTAATACAATAAA
TTAAATAATTTTGAATCTGACTTCTTATTACCAACCAGTGCACCTGCATAGTAAATAAAT
AGTCTTGCATTCAAAGATTTGGTTAATTAAAAACCTAATGACATACCATAAATTACAAGG
ACAAATAGTATAATCAGCAATAAAAAGAGTAGCCCTTCAATTATAGATTAGCAAAATATA
AATCAATTAAAGCAAACAGCTAAACCTTGCATAAATAATACTAAATCAGGAGAATATGAT
TTAATTCAATAGAGCTTAACTATAAATAAAGAGTAAGAATATTCTAGTAACAGCTTAAAA
GAAAAGGCTTAACAACCTTAGCTATCAGGAAAGTAATTGATACTTAATAATAATATTTCA
AATAATAGTTCAATTAACCAAGAAAAAATATTTTCTACAGGTGAAATCATCTAATAATAT
GACAGCAGTAAAAATCTAAGCTAAAATCAAATCAATAAAATTAAAAATGAGCAAATTAGT
TAAATAAATATTGACAAAAATTTTAATGAAAAACCATCTCAAAATGATAAAAAATAATAA
ATGTAGAATGTCAAATCAATCTAGCAATAATAATAGTAGTGTTAGCAACCTGTAAAGTGG
TACCTCTATGATTCATAGGCCTAGTTTGAAGAGCAAGATAATCTTAATAATTTTAATAGT
TATGGAATGCAGCAAAAATAGTAAGTTGCTAAAACTAAAGACCAAATATATCAAAAGTAA
AATAAAGCAAACGTTACAGAAACTTTCCCTGATAATAAGCATTTTTTAAATTCAGAATCT
TCTAGTTTAACTCAAATATCAACCTACAGAGAAGAGAGTTCTAAGTGCATTACAAATGAT
TCATAATTTAATAATTTCAATAATCATTAAGGAAAATAGGTAAATGATATTTAATATTAG
GAATTCAATTACTAGGGTTAATTATAAAGCACAAAACAAGCAAAAGATTTTACAATTAAA
GAAACAAACATGAATTAGCCTTATCAGCTTTGCTAAAAAACAACAAATACTAATACAAAA
TTAGAAAACTGCTCAATCCTTAATAATATAAACGAAATAAAAGATTCATATCATATGGAT
TTTGAAGATCTTGCAAAATATTTTAGTTAAAATAACGGAACAAAGCCTTCTAATAACACT
CCATCATCAGAAAAACAAAAATAAATTTAATCTCAGTTAAAATTAGAAAGCGAAGAGTAC
AAAAATTTGTGTTCATCAATAGAATCTCTTCGTCTTCTAAATACAAAAGATGATCCCTTT
ATAAAAATTCAAAACCAAGAAGATTTCTCGGAAATTTAAAAATTAGCTTTAAAAGGCAGC
ACTACTGATGATAACTTTAGCAACACGAATAAAAATTCAATTATTTATAAAAATAGAGAG
AAATTACAAGATGATATTTCTGAAGCTATAGAATCAGATAGTAGTTTAAATAAAATTAAG
AGTTAGTAAAACCATTTTATAGATGAACCATATTCTATCAACCAGCAAGAGTTTTATAGT
TAATCTAATTTAAATTTGAAATAAAAAAATTTGAATGGTTTTGAAGGTCTTTATTCAATA
GAGGAGGGTGAGTATGAGTTAAAATCTAACCCATATTATGATTAAGATTCTTAAAATAGC
TCTTAATTTAGCTTAAAGGCTGTAGAAGAAGAGTTAGATGATGAAGAAAAATCACAAAGA
TTAAAATAAAGTTCATAAAATAACTCATAGGAAAGTATAAACTCAAATAAATAATCAGAT
TCATAAGAAAAAGCTAATATTTCTTAGCAGTTGAAAGAAAAAGAGGAAGAAGAAAGTATA
GAAGATCCTCAACTCATGTGTGATGAGGAATAAATTTATGAAATGATGAATAGCAATATT
TCTAATATCCTTGACCAAATAAATAATGACGATCCAAACCAAGCCTTCTACTCTAATAAT
TACTATGATTAACCATGCTTTAATATTGAGTCATACAGCAATTTTAAAATAATTCCTTAG
TCTTACAGCAATGCTCCCTCTAATTAGTAATATTTATTTTTTAATTAAAAGAAAATTTAT
TTTATTTATTCAAATTTATATATCAAAAAATAAATTAAAATTTTTTAATTTAAAAAGAAA
ATAAGAAAATGAAACAAATTACTCTTCAAACCCAATGGTTGCTCCTTTTGTAGATGTGCC
TTAATACGATCAAAAGTATCATAATAGCTAGAATAAGAATCTTTCAGAGATTGCAAGCAA
GTCACATAATATAGATCCTAAGGAAAACTAAAAAGAAAATTAAAAGAAAGTAGAGAGTAA
ATAACTGGAAAAAGATGAAAAACCTGTTTAAGAGGAAAACTAGAAAAAAGCTAATAAATC
TATCAGCGCTTTAGGAACCAATCATTAAATTTAATAGAAAAAAACAGAAGAGAACTTATC
TAAAGAATAAAAATTAGCTTTATTGAAAGAATAACTAGCAAACTTTGATAAAATATAAAA
CTAGTTCCCTATTTTCGGAGGAGAACATCTTGCCTACCTACTCTCTAGAGAATCAGATTA
TTAACCAAATCCGTTTTATATGAAGCATTAGAGGTAATTCAGTCCAAACATGAGAGCAAT
TCTATTGGATTGGATGATGGAAGTTAGTGAAGAGTTTGGCTTAAAAAGAGAAACTTATTA
CATTGCTGTAAACTTAGTGGACAGAATGTTTTCTTGTAAACATAATTTACAAATAAAAGA
ATTTTAGTTGATTGGTGTTACTTCTCTACATATTGCTTCTAAATTAGAGGTAATCAATAA
TTTAAAACATTTTACTTAAGTTAAACTCAAATAAAATTAATTATTTGTTGGTTTATTAAA
TACAATTAACAATTTAATAATTATATAATAAAGGAAATTTATCCAAAAAGAGTGGAATAA
TTTATTTTATCAACTGATAATGGATATACAGCACAACTAGTCTTTGAAACTGAAAAAAAT
ATATTATAGGTAAAATTTTACAATTAATTTAATAAGATTTAAACATTTATAAAACAAACA
TTTATTAGAAACTTAATTTTATGGTAAATCCTCCTACGGTTTCGTTCTGGGGTAACTGGT
TCATGTCTTAATGGGATATTTTTATTCAAACTTCTGAAAAAGCATAAAATAGTAAATTAG
TCCTATAATTTTATGAAAACAATAGCTGCTTTGTGCAGTTTAGATAAGCTACCAACTAGT
CCTATGAGTTGTTTAGAGAATACATGTAAATTATGGACTTCTCTATTTTAGATGTACAAA
CTCTCTAAATAAGTGCTACCAAATTACACTGCAGTATTATGTATCTTGTTTTAGGAAAAG
CTCATGGAGTATACACTTTAGATGACATATAAAATGAGGTAGCATAAGGATTCATTTTTA
CAAAAAAAGCCTAGGATTTCAACGATATTTACAATGAATTTGCAAGTGTTTCATTTGGAA
TAAATATTTAAAATATTGTCACTTGCATTTAATATATCTCAAAGTTCTTTGTACTACCTG
TGACCAATGCTTTACCATTTATTATCTCTGAAATGAAAGAGCCTCTTCAAGTAAATAATA
AATTTATACTATATTAATGAAATTAATTTAATTTATTGTAATTAAATAGGGAAATTATGA
AGATTTTCTTTAATACTAAACTCATAATAAAAATTAAATAGAAAAAATAAAAAACATAAT
TTAAAAAGTGTATAAAATAAATGGATGA