Identifiers and Description

Gene Model Identifier

TTHERM_00079530

Standard Name

CYC2 (CYClin)

Aliases

PreTt10198 | 5.m00549 | 3828.m01462 | COI5

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07780 ) Spb1 C-terminal domain
  • ( PF00134 ) cyclin, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00079530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06992.18.00224171858215e-126hypothetical protein (451 aa)
OxytrichaContig3932.0.g18.997498379799854e-17Cyclin, N-terminal domain
SGDYLR210W0.0000020007268868677913CLB4 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the G2/
M transition; may be involved
in DNA replication and spindle
assembly; accumulates during
S phase and G2, then targeted
for ubiquitin-mediated degrada
tion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:27008457: Xu Q, Wang R, Ghanam AR, Yan G, Miao W, Song X (2016) The key role of CYC2 during meiosis in Tetrahymena thermophila. Protein & cell 7(4):236-49
  3. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  4. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  5. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64
  6. Ref:SUPR000104

Sequences

>TTHERM_00079530(coding)
ATGTACATAAGTGGTAAATCAGTTATTTGCGAAAATTTGTTCAGCTCTAATTACTCGAAT
GTCACAAACTCTAACTTTTCTAATCCTCCTCTAGCTAAGTAAGAACCTATAAGTTAAAAT
CTAGTATAAAAGATGTAGTCCAATCCAAACAAGTAGAACTTACAATAAGGCTCAACATTT
GAAAAGCATACCTAGTAAAATTATGCTCTTAAGAGTTGCTCAAGCTAATTTGGTAATAAA
TAATTGGGGATCTTAAAATAAATTGATTAGAATGTAAGTAGAGACACTTAATAATCTTCA
CTGGATCGTTTGGATACTGCAAGACATTATGACAGAGTTATTTAAAGAAATGCTGTAGTA
AATTAAAAGAGTGAATTTTATGAGCATAAGCCAAACTAAGTAGCAAATCAAATGAATGAG
GAAAGCAATCTATTATCTCAACTAGCTTCTCATTGCTTTGCTGCACTAAAAAACTAAAAG
AAGCGAGAAAAAAAATAGAAACAAGATCTTATTAATTACAATAGATTTAATATTCACAAG
AGAGAATTTAATGCTAAAGCATCTAGAGAAAGCTCAAAAGAAAACTTCAAAGGGGCACCT
TCAAATCATGTAAGAAGCAATCTAAGTAGGAAGCAAAGAAGTGAAAGTAGCAACTCGTAA
AAAAATCAATCTTTGGGAAGGAGCAATAAAAAAATAACAGTTGGAATCTTGATGCAATAA
AATGGTAGCCTGTAGAAGAATGGTAATGATTAAAATAGCATGAATAAGATGTAATAGCAA
GAAAACATACACACAAAGTAAATAAGAAATACTTTAAAAGAAATTACAAACATAAAAGTG
AGACACACCAAAAATTCCAGTTAAGACATTCGTAACAACTAGCATATCTAATTTAAAAAA
GTGATGTCCTAATAAGAGACACAAAAAATATCTTCACCATAAAAAGAAGAAAACTTAATC
TCGTAAGAAAGGCTCGAGAATCCCTTGATCAAAGAGCCTTTTATTGCTCTTCAAACTATT
TCTCCAAGAGTTTTCACTAATGAATACTTTTGTTCTCTTGTAAAGCAACAATTGAATCTA
ACAAAACCTCTTGCCAGGCACTAAATAACTGATCCTATACGCTAAAAAATGATAGATTGG
ATGATTGAAGTAGTTGTGTTTGTTTTTACAAAACCTAACATCTCAGCATTTTTTAAAACA
ATAAACTTGATGGATCTATTTTTAAAAAAATCCTAAAAAAAATTTTAAGACAGCGATATT
CACTTAATAGGTGTTTGTTGTTTGATAATTAGCAATCATTTTGAATAAAGAGTTGAAGTT
GGTTTAAATCACTTCTGTCGTGAAATTGCTCATCAAGCTTTCGAAAAGAAAGATATCATA
AATATGAAAATGCATATTCTGTAAACAATAGACTATGATCTAAATTTTTCTACAGTTGCT
GACTTTAACAATTAATATATCGCATTTCTCAAGAAATATTAGAAATTAGGGAACTAATTC
TTGCAATAGTTGACTGAATTATCCTACTATTACATATTGTAATCTCACTATTTTTAAGAG
TAGCTGAGCTATCAACCTAGGATTATATCCCTTGCTTCTATTTTTGTAGCTTTAGAGTTT
TTAATTAATAATAGTAAAGACACTATCCAGGTCATAGATACATAGCTTTCTTCAATTTAA
AAAGCTTTACTTGGAGAATTTAGCTATGAAATGGATCCTTTAATGACAAGTCTTGCATTT
TGCATCAAAAATGTCAAAATGATACATCAAAACTTTGAATAAATCAATCCTAAACTTTTT
AACTATAGAGATAAATTCTAAAAGTTTATCTTGAATTGA


>TTHERM_00079530(protein)
MYISGKSVICENLFSSNYSNVTNSNFSNPPLAKQEPISQNLVQKMQSNPNKQNLQQGSTF
EKHTQQNYALKSCSSQFGNKQLGILKQIDQNVSRDTQQSSLDRLDTARHYDRVIQRNAVV
NQKSEFYEHKPNQVANQMNEESNLLSQLASHCFAALKNQKKREKKQKQDLINYNRFNIHK
REFNAKASRESSKENFKGAPSNHVRSNLSRKQRSESSNSQKNQSLGRSNKKITVGILMQQ
NGSLQKNGNDQNSMNKMQQQENIHTKQIRNTLKEITNIKVRHTKNSSQDIRNNQHIQFKK
VMSQQETQKISSPQKEENLISQERLENPLIKEPFIALQTISPRVFTNEYFCSLVKQQLNL
TKPLARHQITDPIRQKMIDWMIEVVVFVFTKPNISAFFKTINLMDLFLKKSQKKFQDSDI
HLIGVCCLIISNHFEQRVEVGLNHFCREIAHQAFEKKDIINMKMHILQTIDYDLNFSTVA
DFNNQYIAFLKKYQKLGNQFLQQLTELSYYYILQSHYFQEQLSYQPRIISLASIFVALEF
LINNSKDTIQVIDTQLSSIQKALLGEFSYEMDPLMTSLAFCIKNVKMIHQNFEQINPKLF
NYRDKFQKFILN


>TTHERM_00079530(gene)
CAAAAATATAGCTCAACATTAATTTAAAATTTCTAAATTAGTAAAATTTCAATTAATAAA
TTAGTAAATCTAAATTATTAAAAAAGAAAATAAATTCTTCAAAAGTAGAAATTGCAAGAT
TGAAAATGTACATAAGTGGTAAATCAGTTATTTGCGAAAATTTGTTCAGCTCTAATTACT
CGAATGTCACAAACTCTAACTTTTCTAATCCTCCTCTAGCTAAGTAAGAACCTATAAGTT
AAAATCTAGTATAAAAGATGTAGTCCAATCCAAACAAGTAGAACTTACAATAAGGCTCAA
CATTTGAAAAGCATACCTAGTAAAATTATGCTCTTAAGAGTTGCTCAAGCTAATTTGGTA
ATAAATAATTGGGGATCTTAAAATAAATTGATTAGAATGTAAGTAGAGACACTTAATAAT
CTTCACTGGATCGTTTGGATACTGCAAGACATTATGACAGAGTTATTTAAAGAAATGCTG
TAGTAAATTAAAAGAGTGAATTTTATGAGCATAAGCCAAACTAAGTAGCAAATCAAATGA
ATGAGGAAAGCAATCTATTATCTCAACTAGCTTCTCATTGCTTTGCTGCACTAAAAAACT
AAAAGAAGCGAGAAAAAAAATAGAAACAAGATCTTATTAATTACAATAGATTTAATATTC
ACAAGAGAGAATTTAATGCTAAAGCATCTAGAGAAAGCTCAAAAGAAAACTTCAAAGGGG
CACCTTCAAATCATGTAAGAAGCAATCTAAGTAGGAAGCAAAGAAGTGAAAGTAGCAACT
CGTAAAAAAATCAATCTTTGGGAAGGAGCAATAAAAAAATAACAGTTGGAATCTTGATGC
AATAAAATGGTAGCCTGTAGAAGAATGGTAATGATTAAAATAGCATGAATAAGATGTAAT
AGCAAGAAAACATACACACAAAGTAAATAAGAAATACTTTAAAAGAAATTACAAACATAA
AAGTGAGACACACCAAAAATTCCAGTTAAGACATTCGTAACAACTAGCATATCTAATTTA
AAAAAGTGATGTCCTAATAAGAGACACAAAAAATATCTTCACCATAAAAAGAAGAAAACT
TAATCTCGTAAGAAAGGCTCGAGAATCCCTTGATCAAAGAGCCTTTTATTGCTCTTCAAA
CTATTTCTCCAAGAGTTTTCACTAATGAATACTTTTGTTCTCTTGTAAAGCAACAAGTAA
ATTTTATTTAAATTCTATTTTGGATTTCAGTAATCTAAATATATATTTTTTAAGCATTTA
ATTTTTAAATTTAATATTAAAACAATTTTTTAATTGCTGATTTTTATAAATTCATTATTT
ATTTGCTTTTTGTTAAAGAAAATTTATTGGTTAATATAAAAATTATTTTTTATTAAAAGT
TGAATCTAACAAAACCTCTTGCCAGGCACTAAATAACTGATCCTATACGCTAAAAAATGA
TAGATTGGATGATTGAAGTAGTTGTGTTTGTTTTTACAAAACCTAACATCTCAGCATTTT
TTAAAACAATAAACTTGATGGATCTATTTTTAAAAAAATCCTAAAAAAAGTAATAAAATA
TTTATTATTTGATCTTTTTTTACATCTTATTGTAAATAAAACAGATTTTAAGACAGCGAT
ATTCACTTAATAGGTGTTTGTTGTTTGATAATTAGCAATCATTTTGAATAAAGAGTTGAA
GTTGGTTTAAATCACTTCTGTCGTGAAATTGCTCATCAAGCTTTCGAAAAGAAAGATATC
ATAAATATGAAAATGCATATTCTGTAAACAATAGACTATGATCTAAATTTTTCTACAGTT
GCTGACTTTAACAATTAATATATCGCATTTCTCAAGAAATATTAGAAATTAGGGAACTAA
TTCTTGCAATAGTTGACTGAATTATCCTACTATTACATATTGTAATCTCACTATTTTTAA
GAGTAGCTGAGCTATCAACCTAGGATTATATCCCTTGCTTCTATTTTTGTAGCTTTAGAG
TTTTTAATTAATAATAGTAAAGACACTATCCAGGTCATAGATACATAGCTTTCTTCAATT
GTAAATTATTATTAAATATTTTTAATTTAATATTTAACAAAATTAATAGTAAAAAGCTTT
ACTTGGAGAATTTAGCTATGAAATGGATCCTTTAATGACAAGTCTTGCATTTTGCATCAA
AAATGTCAAAATGATACATCAAAACTTTGAATAAATCAATCCTAAACTTTTTAACTATAG
AGATAAATTCTAAAAGTTTATCTTGAATTGAAAACCTCAAAGCATTTCATCATAACCTAC
ATAAAAATAGCTGACTTTTATTCATCTAATAATATAAAATACTAACTAACTATATAAATT
GTGATTGACTTTTAATTAGAATTTATTAAAAAAATATAATTTTGCAAAATAATTATTTAA
TTAAATTTTTAAAATGAGTATTTTTGTTCATTTTATTTATAAAAGTATTTTTTTAAATGA
TTTTATTTATTTAATATTT