Identifiers and Description

Gene Model Identifier

TTHERM_00693080

Standard Name

CYC17 (CYClin 17)

Aliases

PreTt02891 | 107.m00071 | 3753.m00365

Description

Cyclin; N-terminal domain containing protein; regulates activity of cyclin-dependent kinases; expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00693080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18399.13.0009061039838537e-46hypothetical protein (748 aa)
OxytrichaContig19198.0.1.g269.99967697349061e-30Cyclin, N-terminal domain
SGDYPR119W4.998021988471165e-24CLB2 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the tra
nsition from G2 to M phase; ac
cumulates during G2 and M, the
n targeted via a destruction b
ox motif for ubiquitin-mediate
d degradation by the proteasom
e
DictyBaseDDB_G02754933.0007793728221555e-22cycB on chromosome: 2 position
6000211 to 6001649
WormBaseWBGene000008661.000116773704384e-19locus:cyb-2.1 status:Partial
ly_confirmed UniProt:O45926
protein_id:CAA15975.2
Stentor CoeruleusSteCoe_218250.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:SUPR000113

Sequences

>TTHERM_00693080(coding)
ATGTGGGAGAGTAAAATTGAACATAATAGGAGGAGCTAACATTTCCTATCTTAAAATAAT
TTCCAAGACAAAAAAGAAAACATTTAGTAGCCCCCTTTCAAAAACTATGTTTTAGGAGAA
AAAACATAAAAAGTACAGTAAATTAATTAATTGGAAACACAAGAATTCCAACAAAGAGGA
ACCAACAAACATAGAGTATTTGGAAGGGTCATAAATGAAAATGGAGTAAATAGCAATAAC
TATTTTCATAGTTAGCCTTTACAAAAGCAATTTAAGGTTTTTAATCCGTTTGCTTAAGAC
TTCAACTTACTTCAAGACGATCAAAATAAAGAAAATGTATTAACATTTTAGCACAATTTT
CAGAGTGAAGTTCATAAAAATCAATAAACGAAGAATATTAATCAAGAAATTAATAAAGAA
TTAGCTTAATCTGAAAAAAGCTTTTAGATGATTGATGAGAGTGAAAAAATTAACTCCTCA
TCAGAAAGTTAATTGATATAAAATATTTTAAATCTTGACCTTTTAAACACTTCTCAAAGT
ATGATTGAGTAAAATCAAAACTAATTAATTAATTTTTGCTAAGAAAATGACAAATTGAAA
GAATTTCACATTATCAACGAAACAAATTATAACACACTCAAAAGTACTTAAATAGAAAAA
ATTAATTTTTTTGATCGATAATTCATTTCGAATCCAATTTATGTAGCTGAATATGCATAA
GAAATATTCGAATATTTGTAAGCTCATCAAGAGAGATATTTATGTAAAGATAACGTAGAC
CTAAAAGACATGCATACTTAGATAAATGAAACTATGAGATGTATTCTTATTGACTGGCTT
ACTGAAGTTTCCATAAAATACGAATTGAAAGAAGAAACCATCTTCATGTGTATATACATG
CTAGATATCTATTGCAGACTATGCTATCAGGATGGAATACAAATATTAAGAGACCACTAT
TAAAAGATTGGTGTTTCTTGCTTGTATATTTCAAGCAAACTAGAAGAAATTTATCCTCCT
GGAGTAAAAGAATTTGTTAAAATTTGTGATGGAGCTTACAAACTAAAAGATATTATAAGC
ACAGAAACAGATATATGCCTAAAATTATAATTTAACTTCTCCTTTCCTACGCCATTTACA
TTTTTTGTAAGATATTCTAAAATTCTAGGTCACAGTAATCTGCAATATTATCAAGGATTA
TTTATCTTGTATCTTTGTTTTATGCACTCTGAACTCAGTCCAATGTACGTTAAATCCTCA
ATAATTGCTTCTTGTAGTTGCTTTTTAGTTGAAAGCGTTGCTGAAAATATTTGGGACGAA
AAAATTAAATCTCTTTCCTCAATCGTCTACCTTCACCCTACTTCTGATTTTTAATTCTTA
ATGCCAAGCATCCATAAACTAATTTAACTTTATTCGAATCCTTAGTTTCCTTTTGAGGCA
ATTAGAAAAAAGTTTTCATCTGATTCATTTTGTAAAGTTTCTACCACTTTTACCTAAAAC
ATTTCTGATAGCTAAAAAAATTCCTAATAATAATCTTAACAACTAACCAATATTTGA


>TTHERM_00693080(protein)
MWESKIEHNRRSQHFLSQNNFQDKKENIQQPPFKNYVLGEKTQKVQQINQLETQEFQQRG
TNKHRVFGRVINENGVNSNNYFHSQPLQKQFKVFNPFAQDFNLLQDDQNKENVLTFQHNF
QSEVHKNQQTKNINQEINKELAQSEKSFQMIDESEKINSSSESQLIQNILNLDLLNTSQS
MIEQNQNQLINFCQENDKLKEFHIINETNYNTLKSTQIEKINFFDRQFISNPIYVAEYAQ
EIFEYLQAHQERYLCKDNVDLKDMHTQINETMRCILIDWLTEVSIKYELKEETIFMCIYM
LDIYCRLCYQDGIQILRDHYQKIGVSCLYISSKLEEIYPPGVKEFVKICDGAYKLKDIIS
TETDICLKLQFNFSFPTPFTFFVRYSKILGHSNLQYYQGLFILYLCFMHSELSPMYVKSS
IIASCSCFLVESVAENIWDEKIKSLSSIVYLHPTSDFQFLMPSIHKLIQLYSNPQFPFEA
IRKKFSSDSFCKVSTTFTQNISDSQKNSQQQSQQLTNI


>TTHERM_00693080(gene)
ATGGTAAAATAATTTATAAGAAGTAGAATGATTTCATTTTTATTTATTTTAATATTGCAT
AGTGGGAGAGTAAAATTGAACATAATAGGAGGAGCTAACATTTCCTATCTTAAAATAATT
TCCAAGACAAAAAAGAAAACATTTAGTAGCCCCCTTTCAAAAACTATGTTTTAGGAGAAA
AAACATAAAAAGTACAGTAAATTAATTAATTGGAAACACAAGAATTCCAACAAAGAGGAA
CCAACAAACATAGAGTATTTGGAAGGGTCATAAATGAAAATGGAGTAAATAGCAATAACT
ATTTTCATAGTTAGCCTTTACAAAAGCAATTTAAGGTTTTTAATCCGTTTGCTTAAGACT
TCAACTTACTTCAAGACGATCAAAATAAAGTAAATAAAATTTACTTCTAAGAAGCACTTT
TTAAATATTTAAAAAATATAGGAAAATGTATTAACATTTTAGCACAATTTTCAGAGTGAA
GTTCATAAAAATCAATAAACGAAGAATATTAATCAAGAAATTAATAAAGAATTAGCTTAA
TCTGAAAAAAGCTTTTAGATGATTGATGAGAGTGAAAAAATTAACTCCTCATCAGAAAGT
TAATTGATATAAAATATTTTAAATCTTGACCTTTTAAACACTTCTCAAAGTATGATTGAG
TAAAATCAAAACTAATTAATTAATTTTTGCTAAGAAAATGACAAATTGAAAGAATTTCAC
ATTATCAACGAAACAAATTATAACACACTCAAAAGTACTTAAATAGAAAAAATTAATTTT
TTTGATCGATAATTCATTTCGAATCCAATTTATGTAGCTGAATATGCATAAGAAATATTC
GAATATTTGTAAGCTCATCAAGTAAACAAACAAATAAACTTACTTAAAATAGCTTAAAAT
TTTTAATTGTTTTATTTATTACATAAAAGGAGAGATATTTATGTAAAGATAACGTAGACC
TAAAAGACATGCATACTTAGATAAATGAAACTATGAGATGTATTCTTATTGACTGGCTTA
CTGAAGTTTCCATAAAATACGAATTGAAAGAAGAAACCATCTTCATGTGTATATACATGC
TAGATATCTATTGCAGACTATGCTATCAGGATGGAATACAAATATTAAGAGACCACTATT
AAAAGATTGGTGTTTCTTGCTTGTATATTTCAAGCAAACTAGAAGAAATTTATCCTCCTG
GAGTAAAAGAATTTGTTAAAATTTGTGATGGAGCTTACAAACTAAAAGATATTATAAGCA
CAGAAACAGATATATGCCTAAAATTATAATTTAACTTCTCCTTTCCTACGCCATTTACAT
TTTTTGTAAGATATTCTAAAATTCTAGGTCACAGTAATCTGCAATATTATCAAGTTAATT
ATTTCATTTAGAATAAATTTTTCAACTTATTACTTACTAAAAAACTAATAAAAACTATTT
TAATCTTTTTAAAATAGGGATTATTTATCTTGTATCTTTGTTTTATGCACTCTGAACTCA
GTCCAATGTACGTTAAATCCTCAATAATTGCTTCTTGTAGTTGCTTTTTAGTTGAAAGCG
TTGCTGAAAATATTTGGGACGAAAAAATTAAATCTCTTTCCTCAATCGTCTACCTTCACC
CTACTTCTGATTTTTAATTCTTAATGCCAAGCATCCATAAACTAATTTAACTTTATTCGA
ATCCTTAGTTTCCTTTTGAGGCAATTAGAAAAAAGTTTTCATCTGATTCATTTTGTAAAG
TTTCTACCACTTTTACCTAAAACATTTCTGATAGCTAAAAAAATTCCTAATAATAATCTT
AACAACTAACCAATATTTGA