Identifiers and Description

Gene Model Identifier

TTHERM_00780580

Standard Name

CYC16 (CYClin)

Aliases

PreTt01270 | 130.m00080 | 3738.m00016

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00780580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18655.19.997093137033517e-262cyclin domain-containing prote
in (257 aa)
OxytrichaContig22365.0.g493.999582750711782e-108Cyclin
Stentor CoeruleusSteCoe_324081.1379798735078682e-50
DictyBaseDDB_G02776677.000028900755185e-46DDB_G0277667 on chromosome: 2
position 8286817 to 8288311
WormBaseWBGene000226971.0004783691736523e-35locus:cyy-1 Uncharacterized
cyclin-like protein ZK353.1
status:Partially_confirmed U
niProt:P34624 protein_id:CCD
73200.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:SUPR000114

Sequences

>TTHERM_00780580(coding)
ATGCAAAAAGCTCCATAATAGCAAAAGTTTAGTACTTCAAATACTTTGTTTATCCGTCAT
ACGATTTCATCTCCAAATGTGAAATCTATTATTTAGGCAGTAGCTACTATTCTTCACTCT
TAAATGCACGAAGATTTCTAATCAGGAAAAGAAGTTCCTAAAGGTTCTGACCTTCATTTC
TTCTCTGAAGAAAAATATATTGAAGAAAAACCAGAAGAGTTCGATGAAGCTCGTCGTGCC
TTGCTTCGTGAAACTCCATCTGTAGATAACATTTATGAATTTATGAAAGCTCTTTATGAA
TGTGCCAAATTCTCTCCTGAATGCTGCATTATCTGTTTAGTTTACATTAATAGATTGATT
GCATTCACAGGTTTGCCTCTTTATCCAACAAACTGGCGTCCTCTTATCCTTTGCTCTTTA
TTAGTAGCACAAAAAGTATGGGATGACAAGTACTTATCAAATGCTGACTTTGCTTTCATC
TATCCTTTCTTCGTTACTGAAGAAATCAATGCTTTAGAACAAAAGTTCCTTGAATTACTC
TAATACAATGTCACTGTAAAAAGTGCTCTTTATGCTAAATACTACTTTGAATTAAGAGCC
CTCTTTAAAAACGAATCTGAATTCCCCTTAACCCCTCTTGATGTTGATCAAGAAAAGGAA
CTCGAATCAAGATCTTAATAAATGTAAAACAAAGAAAAAGAAAAAGCATAAAAGAATTCT
CTCACTTATAACGAGAAGCAAACCAAAAGACCTAATGCCTCTCTTAATGTATGA


>TTHERM_00780580(protein)
MQKAPQQQKFSTSNTLFIRHTISSPNVKSIIQAVATILHSQMHEDFQSGKEVPKGSDLHF
FSEEKYIEEKPEEFDEARRALLRETPSVDNIYEFMKALYECAKFSPECCIICLVYINRLI
AFTGLPLYPTNWRPLILCSLLVAQKVWDDKYLSNADFAFIYPFFVTEEINALEQKFLELL
QYNVTVKSALYAKYYFELRALFKNESEFPLTPLDVDQEKELESRSQQMQNKEKEKAQKNS
LTYNEKQTKRPNASLNV


>TTHERM_00780580(gene)
ATGCAAAAAGCTCCATAATAGCAAAAGTTTAGTACTTCAAATACTTTGTTTATCCGTCAT
ACGATTTCATCTCCAAATGTGAAATCTATTATTTAGGCAGTAGCTACTATTCTTCACTCT
TAAATGCACGAAGATTTCTAATCAGGAAAAGAAGTTCCTAAAGGTTCTGACCTTCATTTC
TTCTCTGAAGAAAAATATATTGAAGAAAAACCAGAAGAGTTCGATGAAGCTCGTCGTGCC
TTGCTTCGTGAAACTCCATCTGTAGATAACATTTATGAATTTATGAAAGCTCTTTATGAA
TGTGCCAAATTCTCTCCTGAATGCTGCATTATCTGTTTAGTTTACATTAATAGATTGATT
GCATTCACAGGTTTGCCTCTTTATCCAACAAACTGGCGTCCTCTTATCCTTTGCTCTTTA
TTAGTAGCACAAAAAGTATGGGATGACAAGTACTTATCAAATGCTGACTTTGCTTTCATC
TATCCTTTCTTCGTTACTGAAGAAATCAATGCTTTAGAACAAAAGTTCCTTGAATTACTC
TAATACAATGTCACTGTAAAAAGTGCTCTTTATGCTAAATACTACTTTGAATTAAGAGCC
CTCTTTAAAAACGAATCTGAATTCCCCTTAACCCCTCTTGATGTTGATCAAGAAAAGGAA
CTCGAATCAAGATCTTAATAAATGTAAAACAAAGAAAAAGAAAAAGCATAAAAGAATTCT
CTCACTTATAACGAGAAGCAAACCAAAAGACCTAATGCCTCTCTTAATGTATGA