Identifiers and Description

Gene Model Identifier

TTHERM_00189230

Standard Name

CYC14 (CYClin)

Aliases

PreTt08673 | 15.m00384 | 3697.m00096

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00189230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06286.19.997093137033517e-262cyclin domain-containing prote
in (764 aa)
OxytrichaContig12832.0.g493.000555717977434e-27Cyclin, N-terminal domain
DictyBaseDDB_G02754932.999534586690157e-23cycB on chromosome: 2 position
6000211 to 6001649
SGDYDL155W8.000721090200152e-18CLB3 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the G2/
M transition; may be involved
in DNA replication and spindle
assembly; accumulates during
S phase and G2, then targeted
for ubiquitin-mediated degrada
tion
WormBaseWBGene000008636.001122775063233e-17locus:cya-1 G2/mitotic-speci
fic cyclin-A1 status:Confirm
ed UniProt:P34638 protein_
id:CAA82372.1
Stentor CoeruleusSteCoe_286600.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00189230(coding)
ATGTCCATGATTGATGAAAATTCAAATACTATTCCTTTTTTTTAAAAGAGACATTCAATG
AAGAGCACCTATTGTAACTAAAATGACTTAATTTTTTAAAATAAAATGAATTATTCATAA
AGAATGCCTTTTGAAGAAGTTGTTTCGTTACAACCCTAATAAATAATTTACTCTTAAAAG
TCAGTAGCTTGTGAAGATTAGCAAAATATGAAGTAAAGTGTTAAATTTCCTGCTTAAGTT
GGCTAAAACTAATAACAGAGCAGCACTTTAAACAATTACTCAAACGACCTATCTCCTATA
GACATGACATTTTAGTAAATAAGCACTTAAAGTAGCTCTCCTGATTTCGATTTAGCAGTC
ATTAAAAATCCCTCCTCATCTTAAAACGTAAACATAAGCAATAAGTCTAGTTCTTTTGTT
GGGTCTGGGTCTATTAGCGGAATGAGCAGCTTTAAATAAATGAGTAACAACTAATAAAAA
AGCATGAATTAATCTTCATAATAATAAGCAATTGCCAAAGAATATAAAAATTACTCTTAA
AGTGGAAATAGCATGTAGGAGCTAAGTTCTGTTAGCACTAGAGTTAACAGCTATAGTACA
AATGCAAGCTCTGGATTAAATAAAAATAAATCTAGCAACTACACATTCTAAGAAGAGTAA
GATGAGAATTCATAAGTCTGCAGCAATATTTTAATAGATTAGATGGATTGCCAAGAGGTA
GAAGATTTCAGTCTTTATATCTAAGAGTATGAAAAGTAAAATGCAAACTCTAGCTAAGAA
CAATAGAGAAAATAGGCAATTTCCTAAGAAGATATTTATTAAGAGTAACTTTTTGGTGGT
AATCCTCAATACGTTCCTAAGTACGGCTACTAAATAGTCTAACACCTCTTCAAACAACAG
AGAAACTATAAAATAACTGTAATCACTGATCCTAGAGAATTAATTATTAGAGAAAATCTA
ATTGATTTAATGTCTCGTTTGCACACTCACCTTAAGTTGCAAGAAGAAACACTTTATCTT
GCTGTAAATATTTTCGCCAGATACTTAGACGTCTAAAAACAAAACTACTAAAACTAAAAA
ATTGTAACTCTAGTTGCAACTTGTCTCTTCATAGCTGCTAAATACTAAGAAATTTATCCT
CCTCCTCTTCGTGATTTTTTACATGTCCTTAAACTCAATAAAATCCAAGCTAATACTTCT
GATATATGTGATTTAGAAGGAAGCATTCTCAATAAATTAAACTTTTCTCTCTTCGGTCCT
ACTCGTTTACAATTCCTTGAAGCTTATTTCTCTTAAATTACTCTAGACCCATCTCAAGTC
AGCTTTTGCTATTATTTACTTGAACTAACAAACTTAAACCACTCCTTCTACAAATATGAC
CACAGTGAAATTGCTGCTGCATGCATACTTTTAAGTGAAAAATTCAAAAATATTTCTGGC
AAATATTTTTGGAGTGAAAAATTAGAACTAATTACAAACTATAAATAATAAGATGTTTAT
GACTGCGTTGAAGAGCTTTATTAGTACTTAGTTAATGTAGGACACAACAGGAAAAAATTA
TTTATTTACTCCAAATATTCTGAACAAAAATACAAATCTGTTGCTTTGATTGATTATGAC
CTCACTCACAATGTTAATAACTAAACCAACTAAGAAAGCACTTAAGATGGATTTTACATT
TCTACTTCTAATAATCAAAAAAGTGAGAATAACTACTCATAGTAATAAAAAATTTACACA
AATAAGTAAATGACACAATCCTAATAACTATCTTAGTCTTGCAATTAAGGCTATAACAGT
AGCATGACTTAATCAACCTATAACATGACTTATTCATAAAATAGTTAGAACTACGATTCA
TAACAGATACAAGAGTAACAATATTATTCTAAATAAATGTCTTAATAAAACAATTAAATT
GCTTACTCTAAATGCAAATCTGAATGCTATGCTGAGGAATATGACGAAAACTCTGTTAGC
TTTCATTCTTAAGCCAGATAAAATTAACCAAATTTCAAATATGACATTACAAAATACTCA
AAAATTTACTGA


>TTHERM_00189230(protein)
MSMIDENSNTIPFFQKRHSMKSTYCNQNDLIFQNKMNYSQRMPFEEVVSLQPQQIIYSQK
SVACEDQQNMKQSVKFPAQVGQNQQQSSTLNNYSNDLSPIDMTFQQISTQSSSPDFDLAV
IKNPSSSQNVNISNKSSSFVGSGSISGMSSFKQMSNNQQKSMNQSSQQQAIAKEYKNYSQ
SGNSMQELSSVSTRVNSYSTNASSGLNKNKSSNYTFQEEQDENSQVCSNILIDQMDCQEV
EDFSLYIQEYEKQNANSSQEQQRKQAISQEDIYQEQLFGGNPQYVPKYGYQIVQHLFKQQ
RNYKITVITDPRELIIRENLIDLMSRLHTHLKLQEETLYLAVNIFARYLDVQKQNYQNQK
IVTLVATCLFIAAKYQEIYPPPLRDFLHVLKLNKIQANTSDICDLEGSILNKLNFSLFGP
TRLQFLEAYFSQITLDPSQVSFCYYLLELTNLNHSFYKYDHSEIAAACILLSEKFKNISG
KYFWSEKLELITNYKQQDVYDCVEELYQYLVNVGHNRKKLFIYSKYSEQKYKSVALIDYD
LTHNVNNQTNQESTQDGFYISTSNNQKSENNYSQQQKIYTNKQMTQSQQLSQSCNQGYNS
SMTQSTYNMTYSQNSQNYDSQQIQEQQYYSKQMSQQNNQIAYSKCKSECYAEEYDENSVS
FHSQARQNQPNFKYDITKYSKIY


>TTHERM_00189230(gene)
TTTCAGCTGGTCAATCAAACAAAGTAAAAATTAGTCTTTGATTGAGCATATCTTGTTTGT
ATTCGCAGAAAAAAAACATTTAAATTTCAAATATTTTTTGATAAAGTTGAATCTTAATAT
CACTTAGTTTATTAAGGGATATTATTAATGGATATAAGGAAAGACTTTAATTTTTTAATT
TGAAAGTATTTGAAAATTGAATTAAATTATCAATATGAAATCAAAAATTTTACACAGAAT
ATTAATAAATACATATAAAAAAGCACATAAATAAATAAATAATAAAAAGAAAGAAAAAAT
AAAAAATCCCAAATTAAGAATTCTTTAATAGATATATAGATAGATTGATAGATACTTAGA
TAAAAATTAATATCAAGTTTTTTATTTGAATACTAATCACACACAAAGGAATAAAACTCT
ATCAAACAAACACACCAAAAAAACACACAAATAAACAAACAAATCTACCCCTTTCTCTTT
CATATACATTTTATATTCAATTAATCCCTCAAAAAACACCTCCAATAGATTAAATAAATG
ATGTCAACTTTTTAAAAATAGAATTCCTCCCAATATTAAGCTTAGGTAAAATAGTTTTTT
TTATTCAAGATTATTAAGATTATTTTCTTTTTATCAAGATCCATATTCAATAAATAAAAA
CATGATACAAAAAAAAATAGTTTGTGATCAAAATCTTTCTATCCAGTTGTTTCTCCTTCT
CAAAATGCATTTTATTAATCATTCTTTATTTAACCCATAATTAGATTAACAACAACTTAA
TTGTCGAAGAGTACAATTTCATCAATGATTTCACTTAAGATGCTAGTCGTGGAATCCATT
CATAGAATGATTTCAATGCCTAAAATTTATAAAACCCTCTTAGCAATAGATAAAAGCCTG
CTACTTCTATGTCCATGATTGATGAAAATTCAAATACTATTCCTTTTTTTTAAAAGAGAC
ATTCAATGAAGAGCACCTATTGTAACTAAAATGACTTAATTTTTTAAAATAAAATGAATT
ATTCATAAAGAATGCCTTTTGAAGAAGTTGTTTCGTTACAACCCTAATAAATAATTTACT
CTTAAAAGTCAGTAGCTTGTGAAGATTAGCAAAATATGAAGTAAAGTGTTAAATTTCCTG
CTTAAGTTGGCTAAAACTAATAACAGAGCAGCACTTTAAACAATTACTCAAACGACCTAT
CTCCTATAGACATGACATTTTAGTAAATAAGCACTTAAAGTAGCTCTCCTGATTTCGATT
TAGCAGTCATTAAAAATCCCTCCTCATCTTAAAACGTAAACATAAGCAATAAGTCTAGTT
CTTTTGTTGGGTCTGGGTCTATTAGCGGAATGAGCAGCTTTAAATAAATGAGTAACAACT
AATAAAAAAGCATGAATTAATCTTCATAATAATAAGCAATTGCCAAAGAATATAAAAATT
ACTCTTAAAGTGGAAATAGCATGTAGGAGCTAAGTTCTGTTAGCACTAGAGTTAACAGCT
ATAGTACAAATGCAAGCTCTGGATTAAATAAAAATAAATCTAGCAACTACACATTCTAAG
AAGAGTAAGATGAGAATTCATAAGTCTGCAGCAATATTTTAATAGATTAGATGGATTGCC
AAGAGGTAGAAGATTTCAGTCTTTATATCTAAGAGTATGAAAAGTAAAATGCAAACTCTA
GCTAAGAACAATAGAGAAAATAGGCAATTTCCTAAGAAGATATTTATTAAGAGTAACTTT
TTGGTGGTAATCCTCAATACGTTCCTAAGTACGGCTACTAAATAGTCTAACACCTCTTCA
AACAACAGGTAATTACTTATTAAATTATTTCTATCTATTGTTATTGAAAGTCCTAAAGAT
TTTCAAAGATTAAGGATAAAAATATTTCTAAAATAATAAGAATTTGAAATAGAAATAATC
TTGCAAAAATGGCTTCAAAAAGCAATTTAAAATTGAGTTATTCAATATATTCCTTGTTCC
GTTTTCAAGTTTTTAAAGTAAATAAATGGAAAAATATGTGATAGATAAATTATGATTTTT
ATCCGCTATTTTTTTTTTAAATTATTTGATTAAAACCCATAGAAATAATTAATTTTCAAC
AAATTTTTTGCCAAATTTTCTTAATTAAAACCAAAATAATATCAATCAAATAAATTAAAG
AGTTAAATTATAACTTAAAGAAAATCTTTAAACTATCCTTTATTTACAATAAAAAAAATA
TTACTATAATTGATACCTAGATAGATAGGTACATGTTTTATTAAAATTTTGCATCATTAT
TTTTCTAATTTTTCTCAAGATTAAAATAAAAGAAAAATGAAAAATTTGAAATTCATTAAA
TTTTGCGCTTAATTTTACTTTAAATTTATCTTGCATTTATTAATATTTTAATTTTAAAAA
TAAATAGAGAAACTATAAAATAACTGTAATCACTGATCCTAGAGAATTAATTATTAGAGA
AAATCTAATTGATTTAATGTCTCGTTTGCACACTCACCTTAAGTTGCAAGAAGAAACACT
TTATCTTGCTGTAAATATTTTCGCCAGATACTTAGACGTCTAAAAACAAAACTACTAAAA
CTAAAAAATTGTAACTCTAGTTGCAACTTGTCTCTTCATAGCTGCTAAATACTAAGAAAT
TTATCCTCCTCCTCTTCGTGATTTTTTACATGTCCTTAAACTCAATAAAATCCAAGCTAA
TACTTCTGATATATGTGATTTAGAAGGAAGCATTCTCAATAAATTAAACTTTTCTCTCTT
CGGTCCTACTCGTTTACAATTCCTTGAAGCTTATTTCTCTTAAATTACTCTAGACCCATC
TCAAGTCAGCTTTTGCTATTATTTACTTGAACTAACAAACTTAAACCACTCCTTCTACAA
ATATGACCACAGTGAAATTGCTGCTGCATGCATACTTTTAAGTGAAAAATTCAAAAATAT
TTCTGGCAAATATTTTTGGAGTGAAAAATTAGAACTAATTACAAACTATAAATAATAAGA
TGTTTATGACTGCGTTGAAGAGCTTTATTAGTACTTAGTTAATGTAGGACACAACAGGAA
AAAATTATTTATTTACTCCAAATATTCTGAACAAAAATACAAATCTGTTGCTTTGATTGA
TTATGACCTCACTCACAATGTTAATAACTAAACCAACTAAGAAAGCACTTAAGATGGATT
TTACATTTCTACTTCTAATAATCAAAAAAGTGAGAATAACTACTCATAGTAATAAAAAAT
TTACACAAATAAGTAAATGACACAATCCTAATAACTATCTTAGTCTTGCAATTAAGGCTA
TAACAGTAGCATGACTTAATCAACCTATAACATGACTTATTCATAAAATAGTTAGAACTA
CGATTCATAACAGATACAAGAGTAACAATATTATTCTAAATAAATGTCTTAATAAAACAA
TTAAATTGCTTACTCTAAATGCAAATCTGAATGCTATGCTGAGGAATATGACGAAAACTC
TGTTAGCTTTCATTCTTAAGCCAGATAAAATTAACCAAATTTCAAATATGACATTACAAA
ATACTCAAAAATTTACTGATCAATCGTGCATAATATTAACAATAATCTTTAAATATTTAT
CACACATTTATTCATAAAAACATACAACTAATTAATAAAAATAAAAATAATAATAATAAT
GATTTCAATCGGTCTTTTATCAAAAA