Identifiers and Description

Gene Model Identifier

TTHERM_01128530

Standard Name

CYC13 (CYClin)

Aliases

PreTt30032 | 247.m00028 | 3817.m00175

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01128530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20785.19.997093137033517e-262cyclin domain-containing prote
in (802 aa)
OxytrichaContig725.1.g1140.000000000000020000882446601127Cyclin, N-terminal domain
DictyBaseDDB_G02774390.0000009995106777214876cycD on chromosome: 2 position
8066558 to 8068733
SGDYLR210W0.000009002574193719714CLB4 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the G2/
M transition; may be involved
in DNA replication and spindle
assembly; accumulates during
S phase and G2, then targeted
for ubiquitin-mediated degrada
tion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_01128530(coding)
ATGCAAAAAGATTCAAGTTAGATTGGAGATTAATTTCTTTTAAGTCTAGGAAGTTTGACA
TAGAGTGTACCCACTAATATTAGCGCTATGTCTAATTGTTCTTCAGGATAGCAATTTGTA
AGCCATAGCAATACCTTATTAAAAGTATAGTCCTTAGAAGCAACATCTCCTACAGCAGTA
GCAGCTGTTGGATTTTAAAGTCAAAGTTAAAACACTGAAGCAGTAATAAAATCAGGAGAA
TTAAAAAGTGTAATGAGCAGTGACAATTTACTAAATCTGGCACCATCAACATAATCTTAA
GCTCCTCCTTAGGCACCATTTACTCTTACTAGCAGCACTAGTGTAACTATTAGCAGCATT
GGTACTTAAATTTAAAGCTTAACCACTTAGATTCCAAGCAATATGCTATATACATACTTC
AATTGCAAACATCAGGCAATAGTTACATATTCAAAGTGCTAGTTCTGCAAAGAGTGTGGT
GTTAGAATGTATAAAAATGGTTAAATGCTTGCACTCAAGTCTCAGTAGATGAATTACAAA
CTTAACACTAATCCTTTAAGGTTATATTCAAACACATATAAATAGAAAAAGTAAAAAAAC
ACTATTAATTTTTAAGAACACTAAGACTACTTAAAGCAAAGAGAGCGCACTATAAATTAT
GTAATCGATTTGGCTGATAGAATGAGATTGAGTAAATAAACTGCTTTCTTGAGTATTATG
TTCCTTGATTACTTGGTTGCTAATGATACCAATTCAGAATTGTGCACATTTAAAATTAAA
GATCATTTATAAATATTTGGAGCTGTTTGTGTAATGTTAGCAGCAAAAAGTATTGAATTA
GATGAAAGAATACCTTTTTTATCTTCTCTTAAAAAATATATGTGCTTAAATTAATACTCT
AAAGAAGATTTAAGAAAGGCAGAATAGAAGACTGTATAAATTCTGAAATTTAATATGTAG
TTTCCTACTCTTTATGATTTATTGGAGTATTATGGCTCATAAGGTGTTGTTTTTTCTAAT
GATTTATAAAAGGGTACAACATTCACATCAATTTTAAGCCCAACTCCATTTTTATCCAAT
GAAACTAAAAATACAAGTGCAAAGAAAGAACGTTTTATAAATAATAGAACTATAGAGTTA
GAGTTTTAAGGTACCGCTCCTTCTTCTTCAGCACAAAATTAGTAATAGTCAGAGGATAGC
ACTAAAAACAGTTCACCTAATTCGAACGACTATTCCTCAACTCAAGAAACTTCATCTAAA
AATTCAAACAGTGATGAAGCAAACCCCTCATGCTCTCCACCACCTCATTCAAAAATAGTG
GAACCTTAACCTCAAGTAGTTAAAGAATTTGATATTTCACCTATTAAATTATATGATATA
GTATCTAAGATAGAAAAAGATTTTAGCAGAATAGCTTTCTTGGCTATAAAAGATGAGAAA
TTTTACGAATAAGATCTTGAAATCTTAGGAGCTGCTTGTATATGCTATTTAAGAGAAAAA
TAAAATATTTCAAATCCTTACAGAGATGAAATTTTATAAATTTGTAGCTAAGATAGAGCC
TAAGTTTTATCTTGTTGCCTCACTTTTTTATCTAAATTTGATACCTACTTTAAGCCTCAT
AGTTATTTGAATGGATCTACATCCTCTGGAATATCTCCTCTAAAGGACATTAGAACTAAT
TTGAAATAAGGATTCTACACTTCTGATAATTATAAGAGCGCTTCCAATCTAACAACAACA
GCAACTACTCGTATTTTATAAGAAAATAAAAAACCTTTATTTGACAACATTGATTTAAAC
AGCTACAGAATAAGAGAAAAATCATTTGAAAAAATTGGTATTAGCTATTAGAGTTAAAGA
AGCTCTATAGCATCTTAACATGTTTCTAAAAATACTATATCTGGGCTGTAGAATAATAGA
AATAACTTTTTTGAGTATGCTAAACTTAACGAATAGAAAATAAATAATTTAAGCTCAATT
ACTAACATATCAACTTCTAATGCCTCTTCTACTTCTTAAGCAGCTGCAAATAGTGGTATC
GCCTCTAGTTCTAATTAAATACTTTAATCTGGTTCATTAACATCAACATCTTCAAATATT
AATAGCTTATAAAGCAAATTATTGCAATAATAAAACGCTTTCAGCTCAGGCGCTTTTCAT
TCAAGCAGCTCTTCTTCTAACGCATTATCATCTGGCCTTTCTTCTATTAGCTCTTACTAA
AAGCCATATTAGCTAGCATTAAATTAATATTCATCAAAACCACTTCTATCTACTACAACA
TCTACAGTAAATAGTAAGATTCCTTAAAGTATACCTAATTTTGATGACGAAGCTAAATGG
AATAGTCACTTCACTAAAACTATAAATTCAATAAATTTCCGTGCAAGCTCCTTCAACTCT
AACTCATTTTTGAGAAGAAACAAATTTTGA


>TTHERM_01128530(protein)
MQKDSSQIGDQFLLSLGSLTQSVPTNISAMSNCSSGQQFVSHSNTLLKVQSLEATSPTAV
AAVGFQSQSQNTEAVIKSGELKSVMSSDNLLNLAPSTQSQAPPQAPFTLTSSTSVTISSI
GTQIQSLTTQIPSNMLYTYFNCKHQAIVTYSKCQFCKECGVRMYKNGQMLALKSQQMNYK
LNTNPLRLYSNTYKQKKQKNTINFQEHQDYLKQRERTINYVIDLADRMRLSKQTAFLSIM
FLDYLVANDTNSELCTFKIKDHLQIFGAVCVMLAAKSIELDERIPFLSSLKKYMCLNQYS
KEDLRKAEQKTVQILKFNMQFPTLYDLLEYYGSQGVVFSNDLQKGTTFTSILSPTPFLSN
ETKNTSAKKERFINNRTIELEFQGTAPSSSAQNQQQSEDSTKNSSPNSNDYSSTQETSSK
NSNSDEANPSCSPPPHSKIVEPQPQVVKEFDISPIKLYDIVSKIEKDFSRIAFLAIKDEK
FYEQDLEILGAACICYLREKQNISNPYRDEILQICSQDRAQVLSCCLTFLSKFDTYFKPH
SYLNGSTSSGISPLKDIRTNLKQGFYTSDNYKSASNLTTTATTRILQENKKPLFDNIDLN
SYRIREKSFEKIGISYQSQRSSIASQHVSKNTISGLQNNRNNFFEYAKLNEQKINNLSSI
TNISTSNASSTSQAAANSGIASSSNQILQSGSLTSTSSNINSLQSKLLQQQNAFSSGAFH
SSSSSSNALSSGLSSISSYQKPYQLALNQYSSKPLLSTTTSTVNSKIPQSIPNFDDEAKW
NSHFTKTINSINFRASSFNSNSFLRRNKF


>TTHERM_01128530(gene)
ATGCAAAAAGATTCAAGTTAGATTGGAGATTAATTTCTTTTAAGTCTAGGAAGTTTGACA
TAGAGTGTACCCACTAATATTAGCGCTATGTCTAATTGTTCTTCAGGATAGCAATTTGTA
AGCCATAGCAATACCTTATTAAAAGTATAGTCCTTAGAAGCAACATCTCCTACAGCAGTA
GCAGCTGTTGGATTTTAAAGTCAAAGTTAAAACACTGAAGCAGTAATAAAATCAGGAGAA
TTAAAAAGTGTAATGAGCAGTGACAATTTACTAAATCTGGCACCATCAACATAATCTTAA
GCTCCTCCTTAGGCACCATTTACTCTTACTAGCAGCACTAGTGTAACTATTAGCAGCATT
GGTACTTAAATTTAAAGCTTAACCACTTAGATTCCAAGCAATATGCTATATACATACTTC
AATTGCAAACATCAGGCAATAGTTACATATTCAAAGTGCTAGTTCTGCAAAGAGTGTGGT
GTTAGAATGTATAAAGTGTTTTATTTTTTCAATTCATTATTCAACTATGTTCTTTTATAA
TCAGCATTATATTAAAAAAAAATCTTTCAAATATTATAGAATGGTTAAATGCTTGCACTC
AAGTCTCAGTAGATGAATTACAAACTTAACACTAATCCTTTAAGGTTATATTCAAACACA
TATAAATAGAAAAAGTAAAAAAACACTATTAATTTTTAAGAACACTAAGACTACTTAAAG
GTAAATAAAATTTAAAATAAATTAATTATTTTAGATAAACTTAATGGTCCATTGATTTGA
TCTGATTTTATTTTGCAGTTGGGTTTGTTAAATTTATGAAATTGTTATTTTTTAAATTTG
TAATAAAGGATAATATCACTATTCTATAAAAATTTAAAGAAATTAACATGATTTGATGCT
ATGCTTTATCTATTATATTAAGAGACATCTAACAAAAATAAGTGAGTAAGTGAGGTTGAG
ATATGAAGCAAAATATTATAATCTAAACTTCATTGTGAGTTTAAGCAATAGAAAATATAA
AAATCAAAAATCTTTTGTCAAAAATTTTTATTTTTCAAGAAATTCAAAAATAAATAGCAT
GAAATTTCTTAATAAATGCAAAATCTCTTGATTGCGATTACAGCAATTATCCTATACTCC
CTCATATTTTTAACCAACCAATCACTAGGTTTCTTATGTAAAAGAGATTATATTAAAATT
TTTAAAGATCAAATTATCAATTTCATTTAATGAATCCCACATATTACAATTTTTTTCCAG
CTCAAAAAAAGTTTATTTTACAAAATTTTAATTTTAATTGAAAAATCTATACTAAAATTG
AATTTTTGATTCAAATAAAAGTAAAAATAGATAGACTTGCCTACTCACTCTTTTTCAAAT
CAAATTCTAATAGCAAACAACTGTATTTTTAAATTCGTGCTAGATTTAAAACTAAATCAT
TCAATTTGAATTTTTACCTAATCTAATTATATATTTATTTGCTTTAACTGTTTTCATACT
TTATGCTGTTATTTACAACATTCATTCTAAATCTTAAAAATTTAATGTTTAACAAATAGC
AAAGAGAGCGCACTATAAATTATGTAATCGATTTGGCTGATAGAATGAGATTGAGTAAAT
AAACTGCTTTCTTGAGTATTATGTTCCTTGATTACTTGGTTGCTAATGATACCAATTCAG
AATTGTGCACATTTAAAATTAAAGATCATTTATAAATATTTGGAGCTGTTTGTGTAATGT
TAGCAGCAAAAAGTATTGAATTAGATGAAAGAATACCTTTTTTATCTTCTCTTAAAAAAT
ATATGTGCTTAAATTAATACTCTAAAGAAGATTTAAGAAAGGCAGAATAGAAGACTGTAT
AAATTCTGAAATTTAATATGTAGTTTCCTACTCTTTATGATTTATTGGAGTATTATGGCT
CATAAGGTGTTGTTTTTTCTAATGATTTATAAAAGGGTACAACATTCACATCAATTTTAA
GCCCAACTCCATTTTTATCCAATGAAACTAAAAATACAAGTGCAAAGAAAGAACGTTTTA
TAAATAATAGAACTATAGAGTTAGAGTTTTAAGGTACCGCTCCTTCTTCTTCAGCACAAA
ATTAGTAATAGTCAGAGGATAGCACTAAAAACAGTTCACCTAATTCGAACGACTATTCCT
CAACTCAAGAAACTTCATCTAAAAATTCAAACAGTGATGAAGCAAACCCCTCATGCTCTC
CACCACCTCATTCAAAAATAGTGGAACCTTAACCTCAAGTAGTTAAAGAATTTGATATTT
CACCTATTAAATTATATGATATAGTATCTAAGATAGAAAAAGATTTTAGCAGAATAGCTT
TCTTGGCTATAAAAGGTAAAAAATACATTTTTAATGAATTTATAAATTAATTACAATAAT
TTTATTTTCATTTTCTACGATTAATTATTTGGAATAATGAGGACTCAAATATAAAATTAT
AAGAAATAACAAAGCTAACAAAAATAAAAACATAAAAAATCACTAAAAAAATAGAAAAAT
GGATGTATCAAATAAAACTTAATGCTAAAATAATAGCCGTTGCGTTTGTAAATGAATAAA
TAATAATTTTAACTATTGAGTCAGTAATTTAGGAAAAGAAACCCTAAACTAAAAGAACAA
ACAATAAAATATCCTGCAACTTTATTTTATACTGTATTATAGTAAAAGCATGCATCTATG
CATGAATCATCTAAAAATTCATAGAATTTATTAATTAACTAATTTTTAGTTTTTATGGAA
AAAAATTGTTCTAAATAAATCCTATTTAAATATTTAATAAAATTTCTTTTTTATTGAGTC
ATTCAAAAAATACAATTTGCCTCTCTCTATAAATCAGTCAATCAATCAATCTTTCTTCAG
ATTTATTTAAAAATTTTTTTATTAGCTAGCTAAAATTTATTGATAATTCATATAATTTTT
TTTATATTTACTAATAGATGAGAAATTTTACGAATAAGATCTTGAAATCTTAGGAGCTGC
TTGTATATGCTATTTAAGAGAAAAATAAAATATTTCAAATCCTTACAGAGATGAAATTTT
ATAAATTTGTAGCTAAGATAGAGCCTAAGTTTTATCTTGTTGCCTCACTTTTTTATCTAA
ATTTGATACCTACTTTAAGCCTCATAGTTATTTGAATGGATCTACATCCTCTGGAATATC
TCCTCTAAAGGACATTAGAACTAATTTGAAATAAGGATTCTACACTTCTGATAATTATAA
GAGCGCTTCCAATCTAACAACAACAGCAACTACTCGTATTTTATAAGAAAATAAAAAACC
TTTATGTAATATATTATTTTTTAATCCTTTCAAAATTTTATTTATTAAAAATAAAAACTA
ATTCTCGTTTTAAATAACAGTTGACAACATTGATTTAAACAGCTACAGAATAAGAGAAAA
ATCATTTGAAAAAATTGGTATTAGCTATTAGAGTTAAAGAAGCTCTATAGCATCTTAACA
TGTTTCTAAAAATACTATATCTGGGCTGTAGAATAATAGAAATAACTTTTTTGAGTATGC
TAAACTTAACGAATAGAAAATAAATAATTTAAGCTCAATTACTAACATATCAACTTCTAA
TGCCTCTTCTACTTCTTAAGCAGCTGCAAATAGTGGTATCGCCTCTAGTTCTAATTAAAT
ACTTTAATCTGGTTCATTAACATCAACATCTTCAAATATTAATAGCTTATAAAGCAAATT
ATTGCAATAATAAAACGCTTTCAGCTCAGGCGCTTTTCATTCAAGCAGCTCTTCTTCTAA
CGCATTATCATCTGGCCTTTCTTCTATTAGCTCTTACTAAAAGCCATATTAGCTAGCATT
AAATTAATATTCATCAAAACCACTTCTATCTACTACAACATCTACAGTAAATAGTAAGAT
TCCTTAAAGTATACCTAATTTTGATGACGAAGCTAAATGGAATAGTCACTTCACTAAAAC
TATAAATTCAATAAATTTCCGTGCAAGCTCCTTCAACTCTAACTCATTTTTGAGAAGAAA
CAAATTTTGA