Identifiers and Description

Gene Model Identifier

TTHERM_00196590

Standard Name

CYC1 (CYClin)

Aliases

PreTt06844 | 16.m00500

Description

Cyclin, N-terminal domain containing protein; Putative mitotic cyclin; similar to Paramecium CYC1 and CYC2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08613 ) Cyclin
  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain
  • ( PF04947 ) Poxvirus Late Transcription Factor VLTF3
  • ( TIGR01215 ) cell division topological specificity factor
  • ( PF05867 ) Caenorhabditis elegans repeat of unknown

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00196590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03829.19.997093137033517e-262cyclin domain-containing prote
in (435 aa)
OxytrichaContig19213.0.g101.999469658314961e-75Cyclin, N-terminal domain
DictyBaseDDB_G02754934.000904604388404e-59cycB on chromosome: 2 position
6000211 to 6001649
SGDYPR119W9.997441244797434e-45CLB2 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the tra
nsition from G2 to M phase; ac
cumulates during G2 and M, the
n targeted via a destruction b
ox motif for ubiquitin-mediate
d degradation by the proteasom
e
WormBaseWBGene000008682.9986404383886433e-43locus:cyb-3 G2/mitotic-speci
fic cyclin-B3 status:Confirm
ed UniProt:Q10654 protein_
id:CAB03311.2
Stentor CoeruleusSteCoe_327353.6251409191435593e-34

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:12736907: Kovács P, Pállinger E (2003) Effects of indomethacin on the divisional morphogenesis and cytoskeleton-dependent processes of Tetrahymena. Cell biochemistry and function 21(2):169-75
  3. Ref:12183062: Zhang H, Huang X, Tang L, Zhang QJ, Frankel J, Berger JD (2002) A cyclin-dependent protein kinase homologue associated with the basal body domains in the ciliate Tetrahymena thermophila. Biochimica et biophysica acta 1591(1-3):119-128
  4. Ref:11596915: Berger JD (2001) Riding the ciliate cell cycle--a thirty-five-year prospective. The Journal of eukaryotic microbiology 48(5):505-18
  5. Ref:10568031: Zhang H, Adl SM, Berger JD (2000) Two distinct classes of mitotic cyclin homologues, Cyc1 and Cyc2, are involved in cell cycle regulation in the ciliate Paramecium tetraurelia. The Journal of eukaryotic microbiology 46(6):585-96
  6. Ref:SUPR000103

Sequences

>TTHERM_00196590(coding)
ATGGCTTGCCTACAAATGAGAAATGGTGAATAATCCATGTTTGGAGACTCAAACAAATTA
TAAAGCAATCAACTTCGTGCTTTCGGGCGTGAGATTCAAAATATCCCTGACAGTCGCTTT
AATACAAGATCTTAATCAATAAAAGCAAACATGTAGCCTCACCACGCCTAAAAGCTTAGC
ATGGAATTAGATACAAATATAAATGAATAAGAGAACGGAATGAAAAGAAGTTCTCCTAGA
AAATTTTCAATGCATGTGAAGCATTCCTCCGAAGTTCCATAAAACCATTAAAAGAGAATG
TCAAGCTAAATTGACACTGTAAGCAATAATGGAACAGAGCGCTCATATTAAACCAATTAA
ACTGGCCTTTAAAATAAAAATATTGACATGAAAAATATAGAATTTGAATTGAATAGGATT
TCTAAGGAAGACTCTGAAAAACCAACTTTAGTTGCTTAATACTCAAAGCAAATATTCGAT
TATATGCGCTAAAGAGAGATTGCCTTCAAAGTCGGTGAATACATGGAAAAATAAACTTAA
ATCAATGACAGAATGAGAGCCATTTTGGTTGACTGGATTGTGGAAATACATAGAAAGTGT
AAATTGTTACCTGAAACTTTATTTATTACTGTCAATTTAATTGACCGCTTCTTGGATAGA
GCCACATGCACTAGAGATAATTTATAGCTTGTAGGTGTAACTGCTTTGTTCATAGCTTCT
AAATACGAAGAAATATATCCTCCTAATCTTAATGATTTTGTTGAAGCCACCTAGAAAGCT
TACAGAAAAAATGATGTTTTATAAATGGAAGGAAGCATTATTTGTGCCCTAAATTTCAAC
TTAACAGTTCCCACATCTCTCCGTTTCCTTGAAAGATACGGACGCGTTGATAAACTTGAT
AAAAAATCTTTTGACATGAGCTTATATATTCTTTAACTCTGCTTAGTCGAATATAAATTT
GTTAAATACTCAGAATCATTAAAAGCTTGCGCTGCTATCTATCTCACAAATAAGCTATTT
AAAAAGAATATTTGCTGGAGTGATGTCCTCACTGGTCACACTTAACATACCGAGCAATAA
ATTAGACCTTGTGCTCTCGAAATGTGCCTTTTACTTCAATCAGCATCAACTAACTAAACC
CAAGCCGTTCGCAGAAAATTCCTTAGTTCAGAGTATAGCGAAGTAGCAACCATACAAATT
GAAAAAATGAATCCTTCATAATAAAACACACAATAGCATTCATATTAAAATAATTAAAAT
TACCCTCCCAACATTCCTAAATACAACTACAGAGAATAATATTGA


>TTHERM_00196590(protein)
MACLQMRNGEQSMFGDSNKLQSNQLRAFGREIQNIPDSRFNTRSQSIKANMQPHHAQKLS
MELDTNINEQENGMKRSSPRKFSMHVKHSSEVPQNHQKRMSSQIDTVSNNGTERSYQTNQ
TGLQNKNIDMKNIEFELNRISKEDSEKPTLVAQYSKQIFDYMRQREIAFKVGEYMEKQTQ
INDRMRAILVDWIVEIHRKCKLLPETLFITVNLIDRFLDRATCTRDNLQLVGVTALFIAS
KYEEIYPPNLNDFVEATQKAYRKNDVLQMEGSIICALNFNLTVPTSLRFLERYGRVDKLD
KKSFDMSLYILQLCLVEYKFVKYSESLKACAAIYLTNKLFKKNICWSDVLTGHTQHTEQQ
IRPCALEMCLLLQSASTNQTQAVRRKFLSSEYSEVATIQIEKMNPSQQNTQQHSYQNNQN
YPPNIPKYNYREQY


>TTHERM_00196590(gene)
ATGGCTTGCCTACAAATGAGAAATGGTGAATAATCCATGTTTGGAGACTCAAACAAATTA
TAAAGCAATCAACTTCGTGCTTTCGGGCGTGAGATTCAAAATATCCCTGACAGTCGCTTT
GTAAAAATTTTTTTCATTTTTCAAATTAATTTCAAATATCCATCTCTCTTATTTTGATGC
TTTTAAGCTTTTTTTTAAGCTGCTTCAACTAAAAGAGTTTGATGAAAGCTAAAGGGAAAA
GAAGGATATTGTTTCAAATGAAGCCATAGCATAGCTATCTCTCTTTAAAATTTTCTAACA
ATTATTTAATTTATAATAGAATACAAGATCTTAATCAATAAAAGCAAACATGTAGCCTCA
CCACGCCTAAAAGCTTAGCATGGAATTAGATACAAATATAAATGAATAAGAGAACGGAAT
GAAAAGAAGTTCTCCTAGAAAATTTTCAATGCATGTGAAGCATTCCTCCGAAGTTCCATA
AAACCATTAAAAGAGAATGTCAAGCTAAATTGACACTGTAAGCAATAATGGAACAGAGCG
CTCATATTAAACCAATTAAACTGGCCTTTAAAATAAAAATATTGACATGAAAAATATAGA
ATTTGAATTGAATAGGATTTCTAAGGAAGACTCTGAAAAACCAACTTTAGTTGCTTAATA
CTCAAAGCAAATATTCGATTATATGCGCTAAAGAGAGGTAAAAAAATACTTTCAAGCTCA
TTTATTTTATAATGACTCAAAATACCAAAAATGTTTGCCAACTAAAAATCATTTCCTCAG
CAAAGCAATTCATTTTAATTTTGTTAAGCATTCATTTTAAAATAAACATTTTTGTTTTTA
ATTTCCATCAAAGAAGTTGCTATTAAAAATTAAAAGTGATATTTTTGCTTTACGCAATTT
GAAATGTAAATTGAAATATCAAATAAGCAAGCAAGCAAATAAATAAACAAAATCCTTTTA
AATTAATAGAAAAATTTAAAATTAAATTGTAATAAGTATTATCCTAACTAATATTTTCTT
GCAAAATAATTCAAATAGTTTTATTTTTCGAGAGCCAAGTATTTTTTAGTATAATTATTC
GACTACTAATCTCCTGATTTAATTAAATTTGCAAATTAAAAATTGATCACTTTAAAATTC
AATTATTCAAAAATTAAATATCTAATAGAGTTTGTATCTAAATGTTTTTTAATCGAATTT
AAATTATTAACGATTAAACAAACATCTTTTTTAAAAAAGCGGCATGCTTAATTTATATTT
TCTAATTGAGAAATTTCAAATAAAAGGAAAATTATAAAATATTTTAAAATCACTCAATTT
CTAAAATTTATTTTATTCGTAAAATAAACTAGATTGCCTTCAAAGTCGGTGAATACATGG
AAAAATAAACTTAAATCAATGACAGAATGAGAGCCATTTTGGTTGACTGGATTGTGGAAA
TACATAGAAAGTGTAAATTGTTACCTGAAACTTTATTTATTACTGTCAATTTAATTGACC
GCTTCTTGGATAGAGCCACATGCACTAGAGATAATTTATAGCTTGTAGGTGTAACTGCTT
TGTTCATAGCTTCTAAATACGAAGAAATATATCCTCCTAATCTTAATGATTTTGTTGAAG
CCACCTAGAAAGCTTACAGAAAAAATGATGTTTTATAAATGGAAGGAAGCATTATTTGTG
CCCTAAATTTCAACTTAACAGTTCCCACATCTCTCCGTTTCCTTGAAAGATACGGACGCG
TTGATAAACTTGATAAAAAATCTTTTGACATGAGCTTATATATTCTTTAACTCTGCTTAG
TCGAATATAAATTTGTTAAATACTCAGAATCATTAAAAGCTTGCGCTGCTATCTATCTCA
CAAATAAGCTATTTAAAAAGAATATTTGCTGGAGTGATGTCCTCACTGGTCACACTTAAC
ATACCGAGCAATAAATTAGACCTTGTGCTCTCGAAATGTGCCTTTTACTTCAATCAGCAT
CAACTAACTAAACCCAAGCCGTTCGCAGAAAATTCCTTAGTTCAGAGTATAGCGAAGTAG
CAACCATACAAATTGAAAAAATGAATCCTTCATAATAAAACACACAATAGCATTCATATT
AAAATAATTAAAATTACCCTCCCAACATTCCTAAATACAACTACAGAGAATAATATTGA