Identifiers and Description

Gene Model Identifier

TTHERM_00694430

Standard Name

CVP2 (Fusion of subtilisin-like proprotein and teneurin-1.)

Aliases

PreTt02926 | 107.m00106 | 3753.m00398

Description

Fusion of subtilisin-like proprotein and teneurin-1.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00694430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18430.19.997093137033517e-262hypothetical protein (6232 aa)
OxytrichaContig18862.0.g772.0000236365077126e-43hypothetical protein
Stentor CoeruleusSteCoe_214861.185064864233981e-27
DictyBaseDDB_G02710420.000008000552149328928DDB_G0271042 on chromosome: 1
position 4340831 to 4344152
WormBaseWBGene000022990.00003998524687536623locus:let-23 status:Partiall
y_confirmed UniProt:B5BM27
protein_id:CAR31509.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00694430(coding)
ATGGCATTAACTACAAATTGGCTTTTATTTATTTACCTATTTTGCTAATCAATATAAAGA
TTATCTAGCTAATATGTTGGGCATGATCACTGGATGATAGATTCTCCTACCCAGCAAAAC
CATAATGTACAATACAATATATATGAAATAGGTCTGGAGGGATAAGTCATTTTGCAGATT
TCGTAATTTTAATAGTAGAGTCAAAATAATGGAGACATTGATATTAGCTTTTTAATAGAG
TTTCCGTTGAAGAGTTTCAAACATTCTGGCTTTTTTTCAATTGATAGACTTTTGACTTAA
AATTTAGATGAAAACCTACTTCAAGCTGAAAAAGTAGAACTAGAGAGAATATATAGTGAA
GACTATGTTTCTGGTTAATCTTATCAAGTTAAACTCTCTGTAAGATCTAATGGTTATGAA
AATATTTATTTAAAAATATCCTCTATTCAATCAAAAATTAAAATAGAATAAATCTCACAT
ATAACAATAAACACAAATGATCTTACACATAAATTCAGAAATTTATAAACTACTTGCCCT
GATGGATAATATCTTAGTGGTTCTTCATGTTCAGATTGTAACACTAACTGTCTGCAATGT
AATGGTCCAAAAGCCAATAATTGCATCCTTTGTGATGTAACAAAACGTCTAGATGAAAAA
ACTCCCGGCTAATGCTAATAATGTAAAGGAACTTTAAAGTTTAGTGCAGGTGGTGTTGAC
AGATGCTGCTATACCTATCCTGGTCCAAATCCTTGTCCTAGTAAGATCTGCACTTCCAAA
AACAGATGTCCTAATTGTACTGGTAGTACAGATACTTATGATGAAGATAGTAGTAAATGC
ATAAAAAAAGATGATTGCTTAGGTTAACTTCTTGGTCCCAGTGGTGGTAGTCCAAATATG
TATGTTTGCGAGCCTTGCCCTACTGATTAATTGTGGTTTGTTACTCTCAAAAAATGTTAA
GCAGCTACAGATTGCAAAGGAAATAATAGGGTTGTTGGTAAATCGTGTATGGCTTGTCCA
GCTAAATGCTCATCTACCTGTGAATTAGGTAGTGATAAATTATCCCTTGTTTGTCCAGTC
TCCTGTCCACCTGGGCAATTTTTAATGGAAGATGATTCTTGTGGACCTTCCTGCGATGAA
AATAATGGATTCTATAAAGTTCCAAGTTCCATCAGATGTAATGCCTGCCACTCTGATTGC
TAAAGCTGTAATGGTAAGAATCAAACTGATTGCACTGTATGTAGAAAAAAATATAATAAA
AATTCTTCCACAGGGATTTGTGAATGTGATTCTTAGAACGGGTCATTCTTAGATGGTAGT
GGAATTTGTATTGCATGTAGTCCTAATTGTCAAACTTGTAATAAAGTTGGATAAGATTAG
TGTTTGACTTGCAAGGCTAAATAATACAAAAATGAAAAAGGAATATGTGGTGATTGTGAT
ACTTCGAATGGATTCTATTTAGATAAAACTGATTCTATATGTAAAAGTTGTGATCCCACC
TGTAAAACCTGTAACAATAATTAAAAAGATTAATGTTTATCTTGCAATTCACCTACAGCA
TTCGTTTATGATGATGGCTAGTGCAAAGAAGGATGTGATACTAAAAATGGTTTCTATTAA
AAAAATAACCAATGCTTAGCATGTGCCCCAACCTGCCTATAATGCACTTCAAACTCTGAA
GCAAACTGTTAAGTTTGTAGAAATAACTTTTAGATGTAATCTAAAAAATGCACTTGCACA
AATGTATCTGGATATTATTTAGATTTGTTAGATGGCTAATGTAAAACATGTTATTAGAAT
TGTGATTCTTGCTCTGGACCTAAAAAATTTTAATGCCTCACTTGTAAATCTGACTATTCA
CTCTTCCCAGACAATACCTGCTAATTCTGTGATACTTCTAATGGGTATTTTACTGACAAA
TCTAATATCTGTATAAAATGCCATAGTAGCTGCTTAACATGCAATGGTCCTAATGAAGAT
AATTGTCAAAGCTGTCCACTCGGTAAAGGATTAAATAAAGGAAAATGTGATACAGATTGT
GATCAAGAAGATGGAAAATTCATGAATTCAGGTAAATGCAGTGACTGTGCTTCAGGTTGT
CGTAAATGTATTAATAATAGTATGAGTGGTTGCATAAGTTGTGTTGATAAAAACACAATT
CCTAGTGGCACTAGCAATAAAAGAAAATGCAATGGATCATATACCCCTTCAAGTTGTTAA
GCATCAAATGGTATGTATGTAGATTTTAGTACTCCTAGTTCAATTAGTTCCTCAACAGGT
AGCTGCTAGTCTTGTTCAAAAGGAAATTTAATATAACTAATCTACACTCACCCTACAAAT
TAAATACCGACCTCTCTATGCATTCCATGTCCTACCAAAAATGGATATTATTTAAATAGT
AGTAATAATTGCACCAAATGTGATGACTCGTGTTAAGAATGTTAGGATGACACTAAAAAA
TGTTCAGTGTGCAAAAATAATCTCTTTTAAATGCCTGATAAAACTTGTGTTAAAGCTTGT
CCTAATTAATACACTTTCACTAAAGAAGGCAACTGTGTTGAATGCCCTAGTAAATGTAAA
TAAGGTTGTGAGGAAGATTAAAGTTTCTAAATTGTTTGTGCAGTGAAATGCCCTGATGGA
CAATTTATATTTGATGACGATTCTTGTAAAAGTACATGTGATACATTAAATGGATTCTAT
ACTCTTGCAGCTGCTAATAGCTAAACAAGATGTAAAGCTTGCCATAGCAGTTGTATAACA
TGCAGTGGTTCTCAAGAAAATGAATGTATTTCATGCAAGAACGGATTTTAAATAGATCCT
GTTTCTAAAAAATGTATTTGTCCTTCTACTAAATTTTTTATGAATCCAAGTGGATAATGC
GTTGCTTGTCATGCATCTTGTAATACATGTAGTGATATTGGTGAAAATAATTGTTTGACT
TGTGCAGATACCTTAGATAGGTAAGTTAATGGTACTTGTGCGTTGTGTGATAAGGAAAAT
GGTTGGTTTTTAGATTCCTCTTCAGTCTGTTAAAAATGCCATTAATCTTGTTTAAAATGT
ACTTCTCCAGATGCTACAGCTTGCACGAAATGCAAAACAGGAGATTATCTTTATCCTGAC
TCAACATGCAAGACAGGTTGCCCTGAGGTAGGCTTTTTTAAATAAACAGTAAGTGGAATA
GATAACTGTAAAGCATGCGATGAATCTTGTAATAAGTGCAGTGGCCCAAAAAATAATAAT
TGTACTGAATGCTCAAACGGTTTCTAATTAAACTCAAACAAATGTTAATGTCCATCTTCT
GGATTTTTTATCAAATAAGTTGATGACAAATAAACATGTATTGCATGCCATAGATCATGC
AATACCTGTAATGGGGTCGGTAGATTAGAGTGTCAAACTTGTGCCTCTGGTTATGATAAA
TACCCTGATAATAGTTGCTAATTCTGTGATACCAATAATGGATATTTTTTGAATAAGAAT
GTCTGTACTAAATGTGCAGATACTTGTGCTACCTGCAGTAATGCTACAGATTGTAACTCG
TGTTATTATGGATTTGCGCTTAAATCAGATAAGACTTGCACAGAATGTAATACTGAATAA
GGAAAGTTTATGTTAAAAGATAAATGTCAAGATTGTGTATCTGGTTGTAGAAAATGTACA
AATAATTAAATTAATTAATGTACTCACTGTGATGGTAAATATGTTAAATAAGGAAATAAA
GCAAATTTCTGCTCAGCATAATCTTGTGACTCTCCTAAATATATTGATGCATCAAGTGGT
AGTTGCTCAACCTGCTCTAAAGGAAGTGTAGTAATTTATGTTAAAAAAGATGACTAAAAT
TTAAGTGCTAACTGTGTAAAATGTCCTACAAGAAGTGGATATTATCTAGATTCTAGTAAT
AATTGTCAATAATGCTCAGTAAGCGATTGCTAAGAATGCGATGCTAATGATAAATGCATT
ATTTGCGCAAGCCCAAAAAGTTTAAAGCCAGATGGAACATGTTCTGAATCATGTGGAGAC
GGTTTTGTATCAAATGATGAAAGAGTTTGCATTCCATGTATTGAAAACTGTAAAACCTGC
TCATTTTCTATTTCTACTAACAATCCTATTACCACATGTTCAGAATGTAAAGATACTTTT
ACTCTGTTAAAAGATGGAACTTGCTCAAATTGCGATACTAAAAATGGTAAATATCTTGAC
TCTAACTAAATTTGCTAAAATTGTCATGCCACTTGTTAAACATGCTCCGATGATAAAGAA
ATAAGTTGCCTTACTTGTACAAAAAATCTATTTAAATATTAAGGAAAATGTGTTCCTTGT
ACAGATACAGGATTTTCTTAAGTTGGAACTGATTGCATAAAATGTGATACAAGCTGCAAG
ACTTGTTCTGATAGTACAGATAAAGGCTGTATTATTTGTGCAGATGGTCTTACGAAATTT
GAAGATAATACTTGTAAAAAGTGTCCTGATGTTGGTTACTATGTAGATAATTCTGTAGAA
AATGGAGTTTGTAAATAATGTAATCCAAATTGTGTGAAATGTATTGATAATCCTACAAAT
TGTACTGAGTGTGACCATAAAAATAATATCTATTTATTTAAAAACAAAACATGTGGTAAT
TGTGATGTAAGTAATGGATTCTTTATTGCTAACAGCAATACAGAATGCTAAGAATGTGAT
AATTCTTGTTAAACTTGCAATTCATCAGAGAATACAGCATGTTCTAAATGCAAACATGAT
AAGAAAATAGATTTAAATAACCTATGTAATGTCTGCGATATAAATAATGGATTTTATATT
GATGGAGAACATTGTAAAGCTTGTCATAGCTCTTGTAAAACATGTAAAAATGGAGGTAAC
ATAGATGGCTGTATTCTTTGTAAGGATGGCTTGTACATGCACCCTAATTTAGAATGTAAG
GAATGTCATGAAGCAGATGGTGTATTTGTGAATGCTGCTAATAATAATATTTGTACTAAT
TGTAATGATAATTGTAAAACTTGCTTTGGTGATTAATCTAACAATTGTAAGAGTTGTAAA
GGTAGTTTAGTTTTGATGGAAGATAACACTTGTGGTAATTGTGACACTGAAAATGGTCAT
TTCTTGAAAGATAATGTGTGTTATAAATGTGATGATTCTTGTAAGACTTGTAGTGGAAAA
GATAAATCATAATGTATAATATGTGCTGATGGATTGCATAAGAATTCTACCACTGATTTA
TGTGAAGGCTGTAACCTAACTCTAAATAAATATATCGATCCAAGTGACAATAAGTGCTAT
GATTGCGATCCTTCTTGTAACAACTGCTCAGGAAAAGGTAAAGATACTTGCACAAAGTGC
AAAGAAGGTCTCCACAGAAAGCCAGATAATACTTGCTAAGATTGCCCAACAGAAAATTAT
TTTATTTAAGAAGAATTTTGCAAGAGTTGTGATGGTTCTTGCTTAAAATGCACTAACGAG
AAAAATAATTCTTGTACAGCATGCTCTCCTGATAAGTTTTTATATGAAAATGGAACATGT
GGAGAATGTAATGAGTTTGGTTATTTCAAAAAAGATGGTAATTGTTTGAAGTGTGTAGAG
AACTGCAAAGTCTGTAACGATTAAATTTCTTGTGAAGTTTGTCTAGACAATTTTTTCTTT
GATAAGGATCTTAAATGTTCAATATGTCCAAACACTAAATTCTTTATCAAAGATAATAAA
TATTGTTCTAACTGCGATTCTTCTTGCTTAACTTGCAAAGGTGAAAACAAAACAGATTGT
ATAACTTGTGAAGAAAACTATGACAAAATAGATGGTCTATGTATTCCTTGCCCTGTTATT
GGATATTTCAAAAATCATGAAAATAAATGCTTGAAATGCAATGACTCATGCAAAACTTGC
TTAGGGGAAACTGAACATGACTGTGTTGTTTGTGCTGATGGTAAAAAATTCATGGAAGAT
AATACTTGCTAAGAGTGTTAGAATATTGGCTATTTCTTGGGTCCTCTTAACGGAAAAGTT
GAAGTTTGTTAAAAATGTGATGGTACATGTTAGACCTGCAATGGTAAACTTTAAAACTAA
TGTTTATCTTGTTTAGATGGTAAATATCTTTATGATGATAACTCATGTGGAGAATGCACA
GAAAATAAAGTCTTTAGAGTAGATGGTACAATTAACAAATGTGAGAAATGCCATGAAAAG
TGCTTAAAGTGTAATGGAAATTAAGAAAGTAAATGTATTTAATGTTCAGATCCTAATGAA
TATATTCATGAAGATAAATTATGTAAGCCTTGCTTAGTAGAACAAGCACAATTTATCTAG
GGCTTGAATTGTTTTATTTGCCATGAAACATGCTAATAATGTACTGATAAAGGTGAAGAT
AAGTGCACTGTGTGTAAAGGTGATCTTAAGAAGTTAGATGGAAAGTGCTAAGTATGCCCT
ACAGTTGGATATTTTGTTGATGGAGACCAATGCATTAAATGTCATGACTCTTGCAATACT
TGTAATGGAGCAACAGAAGATAAGTGCCTTACATGTAAAAACGACTTTAAAAGAAATGAA
CTCACTAATAAGTGCGAAGAATGTGATATTAACAACAATTTTTTCACCTAAGATGAAATT
TGTTATCCTTGTGATGCTTCTTGCAAAACTTGCTCATCTAAAACGGCTGATTCATGTATT
AAATGTGAAGATAAACTCAGCTTTAATTCTTTAAATTTATGCGTGGAATGCAAAATTAGT
AATGGGTTCTACATAAATGCAAGCAATCACTGCCTCCCATGTTCAAATAATTGTTTAGAA
TGTATTGATAATACTCAATGTACAAAATGCTCAGATACTTTCTTTTTGAGAAAAGATAAA
ACTTGTGGGTTATGTGATGCAAAATAATTCTATGATAGCAGTAATAATTGTTAAGACTGC
CACTCAGATTGCTCCGTCTGCACAGGTCCAGACTAAAATCAATGCACTAAATGTGAAAAT
GCATCTCATTATATTCGCTTGGATTCTAGTATATGTGGAGAATGTGATAAGAATTAATAT
GTAGATTATGGTACTAATAAATGTTAATCATGTCATTTAGATTGCGCTACTTGTAATGGA
CCTTCAGCAACACAATGTTTAACTTGCTCTGATTCTTCTGCATTTATCTGTAAGCAATCA
GATTTAGAATCACTTAATACTAAATTCTCAACTACAAAAACTTGTGAAAAAACATGCTTA
AAATGCCATAGTGATTGTTCAACTTGCTTTGGAGAAACAAAGCAAAGTTGCTTAACCTGC
TCAGATAGTCTAGCAACCGTATAAAAAGATTTCTCATGTTCAAGATGTCCAGAGAGATAG
TTCATGAATGTTGATCAGAAAAAATGTGAGCCTTGCGGTAAAAATTGTATTAATTGCGAT
GACTCTAAAAATTGTACTTTATGCGATGATAGTTATACTAACGTAGAAGGTATTTGTATT
TACTGTGCACCAGGAGAATATTATGATAAAGTTTTATAAAGATGCAATTAATGCCATGAA
GATTGTTAAACATGCTCTGGGGGTTCAAATAAGGATTGTATAGCATGTAAAAAATCAAAT
TATTTCTTTGATTAGAATAATTAGTGTGTAAGCAAATGCGAGTAAGGTTACATCAAAAAA
GAATAAATCAATAAATGCGTTTAATGCTAGTATAAAATACAAGATGGTTAATAAATTTGT
TTACCTGACTGTCCTGAAGGTGAAACTTGCTCATTAGTTTGTGGAAGCAACTCAAAAAAG
ATATCTGATATATTATGTGAGTGTAATGAAGGATTTGAATTCTAGTAAAACTCATTTGAT
ACTTGTTAAATTAAATGTGGAAAGAACTCTAAATTTAAAGATTAAAATAGCTGTGAATGT
AATCCTCACTATGTATTTAGCAATGCTTTAAAAACTGATTGTTAAATAGATTGTAATTTG
AACTCTGTACGAGTTGATGAAAATACTTGTAAATGCTAAGAAGGATTTACATTTATTCCT
TCTTCCTCTAATTAATGCCAAATTGATTGTGGATCTCATGCAATAAGAAAAGATGCAAAT
ACTTGCGAATGTGAGAGTCCTAGCTATGAATTTTCAGTCCCATCTAATATTAACTGCCAT
TTAATTTGTGGATTAAATGCAACTTAAAAAGATGCTGATTCTTGTATTTGTACAAAAGGC
TTTAAATTTATTGAAGGATCTAATACAGCATGCGAAATAGAATGCGGCTAAAATACAATT
CATGTTGATTCTAACACTTGCTAGTGCAAACCTGGTTATGAATTCTAAAAAGACTCTCAA
ACAGAATGTTAAATAATTTGTGGAAAAAATGCAACTTAATCTGACTAAAATACATGCAAA
TGCTTAGATGGGTATGAATTTGAAAAAGGATCAAACACTCAATGCCAAATTAAATGTGGA
TCTCATGCTAAATAAATTGATCCTGAAAAATGCGAATGTGAAAATGGATATTAATTCAAA
GAAAACTCAAAAACTGAATGTCAAATAACCTGTGGGGAGAATGCGATTAATGCTGATTCT
GAAAAATGTAAATGTAAAAGTGAAGAATATAAATTCGTTGATGGATCAAACAAAGAATGT
GAAGTTGTTTGTGGTTTAAATGCTAAACCAAAAGATAGAAATACATGTTCTTGCATAGAA
AATTATGAGCTAATTCCAGGTTCAAGTGCAAATTGCTAATTAAAGTGTGGTGAGAATTCT
AAAAATGAAAATCCTAATAAATGCTAATGTAATCCTGGTTTTAGTTAAGTACATGGTAGT
GATATAGACTGTGAGATAATTTGTGGAGAAAATTCTGTTAGAAAGGATAGAAATACATGT
TAATGTTAAGATGGTTATTAGTTTTATTAAGACTCCAAAACAGTTTGCTCAATAACTTGT
GGAGAAAATGCTGAAAATGATGGCATTAATAAATGCAAATGTAAGGCAGGCTATGCTAAA
GAATCTGGAAGTGAAAGAGACTGTGAATTAATTTGTGGCGAAAACTCAGAGAGAAATGAT
AGAAATAGCTGTAAATGTTTAAGTGGTTACCAGTTTTACTAAGATTCAAAATCTGTTTGT
GCTATTAAATGTGGTTAAAATTCAGAAAATTCAGGAATTAACAGCTGTACTTGTAAGTAA
GGATTCTCTTTAAAAGAAAATTCAAAAGTTGATTGTGAAATTAATTGTGGCTCAAATGCA
GAGAGAGTTGACGAAAATTCATGCAAATGCAAAACAGGATATGAATTTGTAGAGAATTCA
GTGACTTAATGTTAGATAAAGTGTGGTAAAAACGCGAAAAACAAATCTTTTGCTGAATGT
ATGTGCATTTCTGATGAATATGAATTTGAAAATGGTGATAAAAACTCATGCTAAATCAGC
TGCAAAGAAAATTCCACTAAATAGGATATAGATACCTGCAAATGCAATGATGGATATAGT
TTTGTTAAAAATTCAAAAACTTAATGTTAACTAGATTGTGGTGCTCACGCTTCAAACAAA
GACTTAAATAGTTGTTAGTGCAAACAAGATTTTGATTTTATTTCAGGCTCTAAAACTGAA
TGCGAAATTTAATGCATTCAATTTTCATAAAAGATAGATTAAAATACTTGTTCTTGCTTA
GAAGGTTACAAATTTGTTGAAAACTCTATTAACAAGTGCGAGCTCTCATGTGGCAAGTTT
GCTAAAAATTCAGGTCCTGATAAATGTGAATGTGAATATGGATTTAATTAAATATCCAAA
ACAGAGTGCGAAGTTGCTTGCGAATAAAACTCAGAGAAAGAGTCTCAGCATTCATGTAAA
TGTCTAGTAGGTTACGAGTTTACAAAAGAATCTAAAAGATCATGCCAAATAGTTTGTGGA
GCAAACTCAAAAGTTTAAGGATTAGATAAATGCTCTTGTCACAATAACTTCAAATTAGTA
GAAGGAAGTTTAATTGAATGCGAAATTTCATGTGGACCAAATGCTATCTAGCAAGATAAA
AACTCTTGTAAATGTATGGAAGGATTTGAATTCGTTGAAGACTCTGTATTTGAATGTGTT
AAGTCAGTAAAATCTTCAGTAAGTATTTCTGATGTTAAAAACTATGGCTTTTTCTATGCA
ATCATGTTCACAACTTTAGCCTAAGGCATACTCCTGTTTGTTGGTTTCAGACTTGACCAA
CTTGATTCTTTTAGAGTAATCCCTATGCAAAAGGTAAGCTATCTACACACATCTGTTCTT
TAGAGAACGTAGAATAACTTAAAAACTGCTTAGAACTTAGACAATTCTTAAGTCTAAAAA
GTGTAAAATGAAAGCACTTTAGTCGACATGAACAGATATTAATAAAATAATTAAAGCGTT
ATACTTTAAGATGATCCGAATAATGTGTCAATATCAGTTAATCCTATAGAAGTCTAATAA
TAAAATACCTTGATTAACCCTGTTTAACCTTCGCTCCAATAAAAATCAATAATAGCTCTT
GAAAGCCTTGCTTTATAAAATTAGATCACCAATTTTGATTTAACAAAGAAAAAATAATAT
GAAAGTGTACTTGACGAAATAAAACCATAAAAGTTAAGCTAAGCCAAGCATGAGTAGGCA
ATTTAGTATAACTACAGCTTAGCACAAAAGACAGCTACTAACTTAGATGAAACTTAAACT
AGTTAAAAACAAGATTCTAATAAACACTCTTTACTCAAATCTTTTTGTATATATCATGAA
TTGTTTAGTTTATGCTAAAAATCTTACTCCTCATAAAACAGACCTCTTAAGTGTCTATTG
ATTTGGATGAAGCAAATCATTTAAATGGCATTAATTTGTTCATTTTCTTAAGCTCATGTT
ACATTCGGAATAGTTGTAGGTTTAATGGCATTTATAATTTAGCAGATATTAGGTTAAATT
CTCTAAAAGTTAAATTCTTATAACAAATTGATTTGCAGTACTATCAAATACATTATTATT
TTTGGTATAGTTGGAGGATTGTACTATGTAATAATTAAGTCTATGGTTGACCAAATAAAT
TCAAAACAAGTTAGCCAAAGCAATTTAATTGCTCTAACTTACCTAGTTTGCTTTGCTTTT
GATTAAATTTTCATTTAATCAATAGTTGTTATATTTAAACACTTTAAGAAATCCTAATAA
ATTTATAATCTTTCATAGTTAAAATGA


>TTHERM_00694430(protein)
MALTTNWLLFIYLFCQSIQRLSSQYVGHDHWMIDSPTQQNHNVQYNIYEIGLEGQVILQI
SQFQQQSQNNGDIDISFLIEFPLKSFKHSGFFSIDRLLTQNLDENLLQAEKVELERIYSE
DYVSGQSYQVKLSVRSNGYENIYLKISSIQSKIKIEQISHITINTNDLTHKFRNLQTTCP
DGQYLSGSSCSDCNTNCLQCNGPKANNCILCDVTKRLDEKTPGQCQQCKGTLKFSAGGVD
RCCYTYPGPNPCPSKICTSKNRCPNCTGSTDTYDEDSSKCIKKDDCLGQLLGPSGGSPNM
YVCEPCPTDQLWFVTLKKCQAATDCKGNNRVVGKSCMACPAKCSSTCELGSDKLSLVCPV
SCPPGQFLMEDDSCGPSCDENNGFYKVPSSIRCNACHSDCQSCNGKNQTDCTVCRKKYNK
NSSTGICECDSQNGSFLDGSGICIACSPNCQTCNKVGQDQCLTCKAKQYKNEKGICGDCD
TSNGFYLDKTDSICKSCDPTCKTCNNNQKDQCLSCNSPTAFVYDDGQCKEGCDTKNGFYQ
KNNQCLACAPTCLQCTSNSEANCQVCRNNFQMQSKKCTCTNVSGYYLDLLDGQCKTCYQN
CDSCSGPKKFQCLTCKSDYSLFPDNTCQFCDTSNGYFTDKSNICIKCHSSCLTCNGPNED
NCQSCPLGKGLNKGKCDTDCDQEDGKFMNSGKCSDCASGCRKCINNSMSGCISCVDKNTI
PSGTSNKRKCNGSYTPSSCQASNGMYVDFSTPSSISSSTGSCQSCSKGNLIQLIYTHPTN
QIPTSLCIPCPTKNGYYLNSSNNCTKCDDSCQECQDDTKKCSVCKNNLFQMPDKTCVKAC
PNQYTFTKEGNCVECPSKCKQGCEEDQSFQIVCAVKCPDGQFIFDDDSCKSTCDTLNGFY
TLAAANSQTRCKACHSSCITCSGSQENECISCKNGFQIDPVSKKCICPSTKFFMNPSGQC
VACHASCNTCSDIGENNCLTCADTLDRQVNGTCALCDKENGWFLDSSSVCQKCHQSCLKC
TSPDATACTKCKTGDYLYPDSTCKTGCPEVGFFKQTVSGIDNCKACDESCNKCSGPKNNN
CTECSNGFQLNSNKCQCPSSGFFIKQVDDKQTCIACHRSCNTCNGVGRLECQTCASGYDK
YPDNSCQFCDTNNGYFLNKNVCTKCADTCATCSNATDCNSCYYGFALKSDKTCTECNTEQ
GKFMLKDKCQDCVSGCRKCTNNQINQCTHCDGKYVKQGNKANFCSAQSCDSPKYIDASSG
SCSTCSKGSVVIYVKKDDQNLSANCVKCPTRSGYYLDSSNNCQQCSVSDCQECDANDKCI
ICASPKSLKPDGTCSESCGDGFVSNDERVCIPCIENCKTCSFSISTNNPITTCSECKDTF
TLLKDGTCSNCDTKNGKYLDSNQICQNCHATCQTCSDDKEISCLTCTKNLFKYQGKCVPC
TDTGFSQVGTDCIKCDTSCKTCSDSTDKGCIICADGLTKFEDNTCKKCPDVGYYVDNSVE
NGVCKQCNPNCVKCIDNPTNCTECDHKNNIYLFKNKTCGNCDVSNGFFIANSNTECQECD
NSCQTCNSSENTACSKCKHDKKIDLNNLCNVCDINNGFYIDGEHCKACHSSCKTCKNGGN
IDGCILCKDGLYMHPNLECKECHEADGVFVNAANNNICTNCNDNCKTCFGDQSNNCKSCK
GSLVLMEDNTCGNCDTENGHFLKDNVCYKCDDSCKTCSGKDKSQCIICADGLHKNSTTDL
CEGCNLTLNKYIDPSDNKCYDCDPSCNNCSGKGKDTCTKCKEGLHRKPDNTCQDCPTENY
FIQEEFCKSCDGSCLKCTNEKNNSCTACSPDKFLYENGTCGECNEFGYFKKDGNCLKCVE
NCKVCNDQISCEVCLDNFFFDKDLKCSICPNTKFFIKDNKYCSNCDSSCLTCKGENKTDC
ITCEENYDKIDGLCIPCPVIGYFKNHENKCLKCNDSCKTCLGETEHDCVVCADGKKFMED
NTCQECQNIGYFLGPLNGKVEVCQKCDGTCQTCNGKLQNQCLSCLDGKYLYDDNSCGECT
ENKVFRVDGTINKCEKCHEKCLKCNGNQESKCIQCSDPNEYIHEDKLCKPCLVEQAQFIQ
GLNCFICHETCQQCTDKGEDKCTVCKGDLKKLDGKCQVCPTVGYFVDGDQCIKCHDSCNT
CNGATEDKCLTCKNDFKRNELTNKCEECDINNNFFTQDEICYPCDASCKTCSSKTADSCI
KCEDKLSFNSLNLCVECKISNGFYINASNHCLPCSNNCLECIDNTQCTKCSDTFFLRKDK
TCGLCDAKQFYDSSNNCQDCHSDCSVCTGPDQNQCTKCENASHYIRLDSSICGECDKNQY
VDYGTNKCQSCHLDCATCNGPSATQCLTCSDSSAFICKQSDLESLNTKFSTTKTCEKTCL
KCHSDCSTCFGETKQSCLTCSDSLATVQKDFSCSRCPERQFMNVDQKKCEPCGKNCINCD
DSKNCTLCDDSYTNVEGICIYCAPGEYYDKVLQRCNQCHEDCQTCSGGSNKDCIACKKSN
YFFDQNNQCVSKCEQGYIKKEQINKCVQCQYKIQDGQQICLPDCPEGETCSLVCGSNSKK
ISDILCECNEGFEFQQNSFDTCQIKCGKNSKFKDQNSCECNPHYVFSNALKTDCQIDCNL
NSVRVDENTCKCQEGFTFIPSSSNQCQIDCGSHAIRKDANTCECESPSYEFSVPSNINCH
LICGLNATQKDADSCICTKGFKFIEGSNTACEIECGQNTIHVDSNTCQCKPGYEFQKDSQ
TECQIICGKNATQSDQNTCKCLDGYEFEKGSNTQCQIKCGSHAKQIDPEKCECENGYQFK
ENSKTECQITCGENAINADSEKCKCKSEEYKFVDGSNKECEVVCGLNAKPKDRNTCSCIE
NYELIPGSSANCQLKCGENSKNENPNKCQCNPGFSQVHGSDIDCEIICGENSVRKDRNTC
QCQDGYQFYQDSKTVCSITCGENAENDGINKCKCKAGYAKESGSERDCELICGENSERND
RNSCKCLSGYQFYQDSKSVCAIKCGQNSENSGINSCTCKQGFSLKENSKVDCEINCGSNA
ERVDENSCKCKTGYEFVENSVTQCQIKCGKNAKNKSFAECMCISDEYEFENGDKNSCQIS
CKENSTKQDIDTCKCNDGYSFVKNSKTQCQLDCGAHASNKDLNSCQCKQDFDFISGSKTE
CEIQCIQFSQKIDQNTCSCLEGYKFVENSINKCELSCGKFAKNSGPDKCECEYGFNQISK
TECEVACEQNSEKESQHSCKCLVGYEFTKESKRSCQIVCGANSKVQGLDKCSCHNNFKLV
EGSLIECEISCGPNAIQQDKNSCKCMEGFEFVEDSVFECVKSVKSSVSISDVKNYGFFYA
IMFTTLAQGILLFVGFRLDQLDSFRVIPMQKVSYLHTSVLQRTQNNLKTAQNLDNSQVQK
VQNESTLVDMNRYQQNNQSVILQDDPNNVSISVNPIEVQQQNTLINPVQPSLQQKSIIAL
ESLALQNQITNFDLTKKKQYESVLDEIKPQKLSQAKHEQAIQYNYSLAQKTATNLDETQT
SQKQDSNKHSLLKSFCIYHELFSLCQKSYSSQNRPLKCLLIWMKQIIQMALICSFSQAHV
TFGIVVGLMAFIIQQILGQILQKLNSYNKLICSTIKYIIIFGIVGGLYYVIIKSMVDQIN
SKQVSQSNLIALTYLVCFAFDQIFIQSIVVIFKHFKKSQQIYNLSQLK


>TTHERM_00694430(gene)
ATGGCATTAACTACAAATTGGCTTTTATTTATTTACCTATTTTGCTAATCAAGTAAGCAG
ATTTAGCCATTTTCTCACTTCATTTTTTTACTTTCATAAATAAATTTTCATTTTAATTTA
TAAGTTGTTTAAATTATACACTTAGTAATAGTGAGTAAATTTTTATCTAAAGAATTTATT
TTTAACAGTATAAAGATTATCTAGCTAATATGTTGGGCATGATCACTGGATGATAGATTC
TCCTACCCAGCAAAACCATAATGTACAATACAATATATATGAAATAGGTCTGGAGGGATA
AGTCATTTTGCAGATTTCGTAATTTTAATAGTAGAGTCAAAATAATGGAGACATTGATAT
TAGCTTTTTAATAGAGTTTCCGTTGAAGAGTTTCAAGTAAAAAAGAAATTCATAAATATT
TTATTCTAAAGTTAATTCATAAAATTATAGACATTCTGGCTTTTTTTCAATTGATAGACT
TTTGACTTAAAATTTAGATGAAAACCTACTTCAAGCTGAAAAAGTAGAACTAGAGAGAAT
ATATAGTGAAGACTATGTTTCTGGTTAATCTTATCAAGTTAAACTCTCTGTAAGATCTAA
TGGTTATGAAAATATTTATTTAAAAATATCCTCTATTCAATCAAAAATTAAAATAGAATA
AATCTCACATATAACGTAAAAATCCAATTTTTCAATAATTTTTATTAAATTCTCTTATGA
AAAATAGAATAAACACAAATGATCTTACACATAAATTCAGAAATTTATAAACTACTTGCC
CTGATGGATAATATCTTAGTGGTTCTTCATGTTCAGATTGTAACACTAACTGTCTGCAAT
GTAATGGTCCAAAAGCCAATAATTGCATCCTTTGTGATGTAACAAAACGTCTAGATGAAA
AAACTCCCGGCTAATGCTAATAATGTAAAGGAACTTTAAAGTTTAGTGCAGGTGGTGTTG
ACAGATGCTGCTATACCTATCCTGGTCCAAATCCTTGTCCTAGTAAGATCTGCACTTCCA
AAAACAGATGTCCTAATTGTACTGGTAGTACAGATACTTATGATGAAGATAGTAGTAAAT
GCATAAAAAAAGATGATTGCTTAGGTTAACTTCTTGGTCCCAGTGGTGGTAGTCCAAATA
TGTATGTTTGCGAGCCTTGCCCTACTGATTAATTGTGGTTTGTTACTCTCAAAAAATGTT
AAGCAGCTACAGATTGCAAAGGAAATAATAGGGTTGTTGGTAAATCGTGTATGGCTTGTC
CAGCTAAATGCTCATCTACCTGTGAATTAGGTAGTGATAAATTATCCCTTGTTTGTCCAG
TCTCCTGTCCACCTGGGCAATTTTTAATGGAAGATGATTCTTGTGGACCTTCCTGCGATG
AAAATAATGGATTCTATAAAGTTCCAAGTTCCATCAGATGTAATGCCTGCCACTCTGATT
GCTAAAGCTGTAATGGTAAGAATCAAACTGATTGCACTGTATGTAGAAAAAAATATAATA
AAAATTCTTCCACAGGGATTTGTGAATGTGATTCTTAGAACGGGTCATTCTTAGATGGTA
GTGGAATTTGTATTGCATGTAGTCCTAATTGTCAAACTTGTAATAAAGTTGGATAAGATT
AGTGTTTGACTTGCAAGGCTAAATAATACAAAAATGAAAAAGGAATATGTGGTGATTGTG
ATACTTCGAATGGATTCTATTTAGATAAAACTGATTCTATATGTAAAAGTTGTGATCCCA
CCTGTAAAACCTGTAACAATAATTAAAAAGATTAATGTTTATCTTGCAATTCACCTACAG
CATTCGTTTATGATGATGGCTAGTGCAAAGAAGGATGTGATACTAAAAATGGTTTCTATT
AAAAAAATAACCAATGCTTAGCATGTGCCCCAACCTGCCTATAATGCACTTCAAACTCTG
AAGCAAACTGTTAAGTTTGTAGAAATAACTTTTAGATGTAATCTAAAAAATGCACTTGCA
CAAATGTATCTGGATATTATTTAGATTTGTTAGATGGCTAATGTAAAACATGTTATTAGA
ATTGTGATTCTTGCTCTGGACCTAAAAAATTTTAATGCCTCACTTGTAAATCTGACTATT
CACTCTTCCCAGACAATACCTGCTAATTCTGTGATACTTCTAATGGGTATTTTACTGACA
AATCTAATATCTGTATAAAATGCCATAGTAGCTGCTTAACATGCAATGGTCCTAATGAAG
ATAATTGTCAAAGCTGTCCACTCGGTAAAGGATTAAATAAAGGAAAATGTGATACAGATT
GTGATCAAGAAGATGGAAAATTCATGAATTCAGGTAAATGCAGTGACTGTGCTTCAGGTT
GTCGTAAATGTATTAATAATAGTATGAGTGGTTGCATAAGTTGTGTTGATAAAAACACAA
TTCCTAGTGGCACTAGCAATAAAAGAAAATGCAATGGATCATATACCCCTTCAAGTTGTT
AAGCATCAAATGGTATGTATGTAGATTTTAGTACTCCTAGTTCAATTAGTTCCTCAACAG
GTAGCTGCTAGTCTTGTTCAAAAGGAAATTTAATATAACTAATCTACACTCACCCTACAA
ATTAAATACCGACCTCTCTATGCATTCCATGTCCTACCAAAAATGGATATTATTTAAATA
GTAGTAATAATTGCACCAAATGTGATGACTCGTGTTAAGAATGTTAGGATGACACTAAAA
AATGTTCAGTGTGCAAAAATAATCTCTTTTAAATGCCTGATAAAACTTGTGTTAAAGCTT
GTCCTAATTAATACACTTTCACTAAAGAAGGCAACTGTGTTGAATGCCCTAGTAAATGTA
AATAAGGTTGTGAGGAAGATTAAAGTTTCTAAATTGTTTGTGCAGTGAAATGCCCTGATG
GACAATTTATATTTGATGACGATTCTTGTAAAAGTACATGTGATACATTAAATGGATTCT
ATACTCTTGCAGCTGCTAATAGCTAAACAAGATGTAAAGCTTGCCATAGCAGTTGTATAA
CATGCAGTGGTTCTCAAGAAAATGAATGTATTTCATGCAAGAACGGATTTTAAATAGATC
CTGTTTCTAAAAAATGTATTTGTCCTTCTACTAAATTTTTTATGAATCCAAGTGGATAAT
GCGTTGCTTGTCATGCATCTTGTAATACATGTAGTGATATTGGTGAAAATAATTGTTTGA
CTTGTGCAGATACCTTAGATAGGTAAGTTAATGGTACTTGTGCGTTGTGTGATAAGGAAA
ATGGTTGGTTTTTAGATTCCTCTTCAGTCTGTTAAAAATGCCATTAATCTTGTTTAAAAT
GTACTTCTCCAGATGCTACAGCTTGCACGAAATGCAAAACAGGAGATTATCTTTATCCTG
ACTCAACATGCAAGACAGGTTGCCCTGAGGTAGGCTTTTTTAAATAAACAGTAAGTGGAA
TAGATAACTGTAAAGCATGCGATGAATCTTGTAATAAGTGCAGTGGCCCAAAAAATAATA
ATTGTACTGAATGCTCAAACGGTTTCTAATTAAACTCAAACAAATGTTAATGTCCATCTT
CTGGATTTTTTATCAAATAAGTTGATGACAAATAAACATGTATTGCATGCCATAGATCAT
GCAATACCTGTAATGGGGTCGGTAGATTAGAGTGTCAAACTTGTGCCTCTGGTTATGATA
AATACCCTGATAATAGTTGCTAATTCTGTGATACCAATAATGGATATTTTTTGAATAAGA
ATGTCTGTACTAAATGTGCAGATACTTGTGCTACCTGCAGTAATGCTACAGATTGTAACT
CGTGTTATTATGGATTTGCGCTTAAATCAGATAAGACTTGCACAGAATGTAATACTGAAT
AAGGAAAGTTTATGTTAAAAGATAAATGTCAAGATTGTGTATCTGGTTGTAGAAAATGTA
CAAATAATTAAATTAATTAATGTACTCACTGTGATGGTAAATATGTTAAATAAGGAAATA
AAGCAAATTTCTGCTCAGCATAATCTTGTGACTCTCCTAAATATATTGATGCATCAAGTG
GTAGTTGCTCAACCTGCTCTAAAGGAAGTGTAGTAATTTATGTTAAAAAAGATGACTAAA
ATTTAAGTGCTAACTGTGTAAAATGTCCTACAAGAAGTGGATATTATCTAGATTCTAGTA
ATAATTGTCAATAATGCTCAGTAAGCGATTGCTAAGAATGCGATGCTAATGATAAATGCA
TTATTTGCGCAAGCCCAAAAAGTTTAAAGCCAGATGGAACATGTTCTGAATCATGTGGAG
ACGGTTTTGTATCAAATGATGAAAGAGTTTGCATTCCATGTATTGAAAACTGTAAAACCT
GCTCATTTTCTATTTCTACTAACAATCCTATTACCACATGTTCAGAATGTAAAGATACTT
TTACTCTGTTAAAAGATGGAACTTGCTCAAATTGCGATACTAAAAATGGTAAATATCTTG
ACTCTAACTAAATTTGCTAAAATTGTCATGCCACTTGTTAAACATGCTCCGATGATAAAG
AAATAAGTTGCCTTACTTGTACAAAAAATCTATTTAAATATTAAGGAAAATGTGTTCCTT
GTACAGATACAGGATTTTCTTAAGTTGGAACTGATTGCATAAAATGTGATACAAGCTGCA
AGACTTGTTCTGATAGTACAGATAAAGGCTGTATTATTTGTGCAGATGGTCTTACGAAAT
TTGAAGATAATACTTGTAAAAAGTGTCCTGATGTTGGTTACTATGTAGATAATTCTGTAG
AAAATGGAGTTTGTAAATAATGTAATCCAAATTGTGTGAAATGTATTGATAATCCTACAA
ATTGTACTGAGTGTGACCATAAAAATAATATCTATTTATTTAAAAACAAAACATGTGGTA
ATTGTGATGTAAGTAATGGATTCTTTATTGCTAACAGCAATACAGAATGCTAAGAATGTG
ATAATTCTTGTTAAACTTGCAATTCATCAGAGAATACAGCATGTTCTAAATGCAAACATG
ATAAGAAAATAGATTTAAATAACCTATGTAATGTCTGCGATATAAATAATGGATTTTATA
TTGATGGAGAACATTGTAAAGCTTGTCATAGCTCTTGTAAAACATGTAAAAATGGAGGTA
ACATAGATGGCTGTATTCTTTGTAAGGATGGCTTGTACATGCACCCTAATTTAGAATGTA
AGGAATGTCATGAAGCAGATGGTGTATTTGTGAATGCTGCTAATAATAATATTTGTACTA
ATTGTAATGATAATTGTAAAACTTGCTTTGGTGATTAATCTAACAATTGTAAGAGTTGTA
AAGGTAGTTTAGTTTTGATGGAAGATAACACTTGTGGTAATTGTGACACTGAAAATGGTC
ATTTCTTGAAAGATAATGTGTGTTATAAATGTGATGATTCTTGTAAGACTTGTAGTGGAA
AAGATAAATCATAATGTATAATATGTGCTGATGGATTGCATAAGAATTCTACCACTGATT
TATGTGAAGGCTGTAACCTAACTCTAAATAAATATATCGATCCAAGTGACAATAAGTGCT
ATGATTGCGATCCTTCTTGTAACAACTGCTCAGGAAAAGGTAAAGATACTTGCACAAAGT
GCAAAGAAGGTCTCCACAGAAAGCCAGATAATACTTGCTAAGATTGCCCAACAGAAAATT
ATTTTATTTAAGAAGAATTTTGCAAGAGTTGTGATGGTTCTTGCTTAAAATGCACTAACG
AGAAAAATAATTCTTGTACAGCATGCTCTCCTGATAAGTTTTTATATGAAAATGGAACAT
GTGGAGAATGTAATGAGTTTGGTTATTTCAAAAAAGATGGTAATTGTTTGAAGTGTGTAG
AGAACTGCAAAGTCTGTAACGATTAAATTTCTTGTGAAGTTTGTCTAGACAATTTTTTCT
TTGATAAGGATCTTAAATGTTCAATATGTCCAAACACTAAATTCTTTATCAAAGATAATA
AATATTGTTCTAACTGCGATTCTTCTTGCTTAACTTGCAAAGGTGAAAACAAAACAGATT
GTATAACTTGTGAAGAAAACTATGACAAAATAGATGGTCTATGTATTCCTTGCCCTGTTA
TTGGATATTTCAAAAATCATGAAAATAAATGCTTGAAATGCAATGACTCATGCAAAACTT
GCTTAGGGGAAACTGAACATGACTGTGTTGTTTGTGCTGATGGTAAAAAATTCATGGAAG
ATAATACTTGCTAAGAGTGTTAGAATATTGGCTATTTCTTGGGTCCTCTTAACGGAAAAG
TTGAAGTTTGTTAAAAATGTGATGGTACATGTTAGACCTGCAATGGTAAACTTTAAAACT
AATGTTTATCTTGTTTAGATGGTAAATATCTTTATGATGATAACTCATGTGGAGAATGCA
CAGAAAATAAAGTCTTTAGAGTAGATGGTACAATTAACAAATGTGAGAAATGCCATGAAA
AGTGCTTAAAGTGTAATGGAAATTAAGAAAGTAAATGTATTTAATGTTCAGATCCTAATG
AATATATTCATGAAGATAAATTATGTAAGCCTTGCTTAGTAGAACAAGCACAATTTATCT
AGGGCTTGAATTGTTTTATTTGCCATGAAACATGCTAATAATGTACTGATAAAGGTGAAG
ATAAGTGCACTGTGTGTAAAGGTGATCTTAAGAAGTTAGATGGAAAGTGCTAAGTATGCC
CTACAGTTGGATATTTTGTTGATGGAGACCAATGCATTAAATGTCATGACTCTTGCAATA
CTTGTAATGGAGCAACAGAAGATAAGTGCCTTACATGTAAAAACGACTTTAAAAGAAATG
AACTCACTAATAAGTGCGAAGAATGTGATATTAACAACAATTTTTTCACCTAAGATGAAA
TTTGTTATCCTTGTGATGCTTCTTGCAAAACTTGCTCATCTAAAACGGCTGATTCATGTA
TTAAATGTGAAGATAAACTCAGCTTTAATTCTTTAAATTTATGCGTGGAATGCAAAATTA
GTAATGGGTTCTACATAAATGCAAGCAATCACTGCCTCCCATGTTCAAATAATTGTTTAG
AATGTATTGATAATACTCAATGTACAAAATGCTCAGATACTTTCTTTTTGAGAAAAGATA
AAACTTGTGGGTTATGTGATGCAAAATAATTCTATGATAGCAGTAATAATTGTTAAGACT
GCCACTCAGATTGCTCCGTCTGCACAGGTCCAGACTAAAATCAATGCACTAAATGTGAAA
ATGCATCTCATTATATTCGCTTGGATTCTAGTATATGTGGAGAATGTGATAAGAATTAAT
ATGTAGATTATGGTACTAATAAATGTTAATCATGTCATTTAGATTGCGCTACTTGTAATG
GACCTTCAGCAACACAATGTTTAACTTGCTCTGATTCTTCTGCATTTATCTGTAAGCAAT
CAGATTTAGAATCACTTAATACTAAATTCTCAACTACAAAAACTTGTGAAAAAACATGCT
TAAAATGCCATAGTGATTGTTCAACTTGCTTTGGAGAAACAAAGCAAAGTTGCTTAACCT
GCTCAGATAGTCTAGCAACCGTATAAAAAGATTTCTCATGTTCAAGATGTCCAGAGAGAT
AGTTCATGAATGTTGATCAGAAAAAATGTGAGCCTTGCGGTAAAAATTGTATTAATTGCG
ATGACTCTAAAAATTGTACTTTATGCGATGATAGTTATACTAACGTAGAAGGTATTTGTA
TTTACTGTGCACCAGGAGAATATTATGGTAAGATTTTTTATTTTTAAATAACTTTTTAAT
AACTTAAATTTTTCTAACTTTATAGATAAAGTTTTATAAAGATGCAATTAATGCCATGAA
GATTGTTAAACATGCTCTGGGGGTTCAAATAAGGATTGTATAGCATGTAAAAAATCAAAT
TATTTCTTTGATTAGAATAATTAGTGTGTAAGCAAATGCGAGTAAGGTTACATCAAAAAA
GAATAAATCAATAAATGCGTTTAATGCTAGTATAAAATACAAGATGGTTAATAAATTTGT
TTACCTGACTGTCCTGAAGGTGAAACTTGCTCATTAGTTTGTGGAAGCAACTCAAAAAAG
ATATCTGATATATTATGTGAGTGTAATGAAGGATTTGAATTCTAGTAAAACTCATTTGAT
ACTTGTTAAATTAAATGTGGAAAGAACTCTAAATTTAAAGATTAAAATAGCTGTGAATGT
AATCCTCACTATGTATTTAGCAATGCTTTAAAAACTGATTGTTAAATAGATTGTAATTTG
AACTCTGTACGAGTTGATGAAAATACTTGTAAATGCTAAGAAGGATTTACATTTATTCCT
TCTTCCTCTAATTAATGCCAAATTGATTGTGGATCTCATGCAATAAGAAAAGATGCAAAT
ACTTGCGAATGTGAGAGTCCTAGCTATGAATTTTCAGTCCCATCTAATATTAACTGCCAT
TTAATTTGTGGATTAAATGCAACTTAAAAAGATGCTGATTCTTGTATTTGTACAAAAGGC
TTTAAATTTATTGAAGGATCTAATACAGCATGCGAAATAGAATGCGGCTAAAATACAATT
CATGTTGATTCTAACACTTGCTAGTGCAAACCTGGTTATGAATTCTAAAAAGACTCTCAA
ACAGAATGTTAAATAATTTGTGGAAAAAATGCAACTTAATCTGACTAAAATACATGCAAA
TGCTTAGATGGGTATGAATTTGAAAAAGGATCAAACACTCAATGCCAAATTAAATGTGGA
TCTCATGCTAAATAAATTGATCCTGAAAAATGCGAATGTGAAAATGGATATTAATTCAAA
GAAAACTCAAAAACTGAATGTCAAATAACCTGTGGGGAGAATGCGATTAATGCTGATTCT
GAAAAATGTAAATGTAAAAGTGAAGAATATAAATTCGTTGATGGATCAAACAAAGAATGT
GAAGTTGTTTGTGGTTTAAATGCTAAACCAAAAGATAGAAATACATGTTCTTGCATAGAA
AATTATGAGCTAATTCCAGGTTCAAGTGCAAATTGCTAATTAAAGTGTGGTGAGAATTCT
AAAAATGAAAATCCTAATAAATGCTAATGTAATCCTGGTTTTAGTTAAGTACATGGTAGT
GATATAGACTGTGAGATAATTTGTGGAGAAAATTCTGTTAGAAAGGATAGAAATACATGT
TAATGTTAAGATGGTTATTAGTTTTATTAAGACTCCAAAACAGTTTGCTCAATAACTTGT
GGAGAAAATGCTGAAAATGATGGCATTAATAAATGCAAATGTAAGGCAGGCTATGCTAAA
GAATCTGGAAGTGAAAGAGACTGTGAATTAATTTGTGGCGAAAACTCAGAGAGAAATGAT
AGAAATAGCTGTAAATGTTTAAGTGGTTACCAGTTTTACTAAGATTCAAAATCTGTTTGT
GCTATTAAATGTGGTTAAAATTCAGAAAATTCAGGAATTAACAGCTGTACTTGTAAGTAA
GGATTCTCTTTAAAAGAAAATTCAAAAGTTGATTGTGAAATTAATTGTGGCTCAAATGCA
GAGAGAGTTGACGAAAATTCATGCAAATGCAAAACAGGATATGAATTTGTAGAGAATTCA
GTGACTTAATGTTAGATAAAGTGTGGTAAAAACGCGAAAAACAAATCTTTTGCTGAATGT
ATGTGCATTTCTGATGAATATGAATTTGAAAATGGTGATAAAAACTCATGCTAAATCAGC
TGCAAAGAAAATTCCACTAAATAGGATATAGATACCTGCAAATGCAATGATGGATATAGT
TTTGTTAAAAATTCAAAAACTTAATGTTAACTAGATTGTGGTGCTCACGCTTCAAACAAA
GACTTAAATAGTTGTTAGTGCAAACAAGATTTTGATTTTATTTCAGGCTCTAAAACTGAA
TGCGAAATTTAATGCATTCAATTTTCATAAAAGATAGATTAAAATACTTGTTCTTGCTTA
GAAGGTTACAAATTTGTTGAAAACTCTATTAACAAGTGCGAGCTCTCATGTGGCAAGTTT
GCTAAAAATTCAGGTCCTGATAAATGTGAATGTGAATATGGATTTAATTAAATATCCAAA
ACAGAGTGCGAAGTTGCTTGCGAATAAAACTCAGAGAAAGAGTCTCAGCATTCATGTAAA
TGTCTAGTAGGTTACGAGTTTACAAAAGAATCTAAAAGATCATGCCAAATAGTTTGTGGA
GCAAACTCAAAAGTTTAAGGATTAGATAAATGCTCTTGTCACAATAACTTCAAATTAGTA
GAAGGAAGTTTAATTGAATGCGAAATTTCATGTGGACCAAATGCTATCTAGCAAGATAAA
AACTCTTGTAAATGTATGGAAGGATTTGAATTCGTTGAAGACTCTGTATTTGAATGTGTT
AAGTCAGTAAAATCTTCAGTAAGTATTTCTGATGTTAAAAACTATGGCTTTTTCTATGCA
ATCATGTTCACAACTTTAGCCTAAGGCATACTCCTGTTTGTTGGTTTCAGACTTGACCAA
CTTGATTCTTTTAGAGTAATCCCTATGCAAAAGGTAAGCTATCTACACACATCTGTTCTT
TAGAGAACGTAGAATAACTTAAAAACTGCTTAGAACTTAGACAATTCTTAAGTCTAAAAA
GTGTAAAATGAAAGTAAAAAATATATTTTTGTATTTTATTTAATAAAATTTTTATTTTTA
AATTAAATAGGCACTTTAGTCGACATGAACAGATATTAATAAAATAATTAAAGCGTTATA
CTTTAAGATGATCCGAATAATGTGTCAATATCAGTTAATCCTATAGAAGTCTAATAATAA
AATACCTTGATTAACCCTGTTTAACCTTCGCTCCAATAAAAATCAATAATAGCTCTTGAA
AGCCTTGCTTTATAAAATTAGATCACCAATTTTGATTTAACAAAGAAAAAATAATATGAA
AGTAAATTTTTTTCTATTTATGATAATTGTTAAATTTTATTTTTAAATAGGTGTACTTGA
CGAAATAAAACCATAAAAGTTAAGCTAAGCCAAGCATGAGTAGGCAATTTAGTATAACTA
CAGCTTAGCACAAAAGACAGCTACTAACTTAGATGAAACTTAAACTAGTTAAAAACAAGA
TTCTAATAAACACTCTTTACTCAAATCTTTTTGTGTAAAAAAAATATTTTCTTTAATTTT
TCTAAACTAATTTATATTTAAATAACTAGATATATCATGAATTGTTTAGTTTATGCTAAA
AATCTTACTCCTCATAAAACAGACCTCTTAAGTGTCTATTGATTTGGATGAAGCAAATCA
TTTAAATGGCATTAATTTGTTCATTTTCTTAAGTAAATAAATAATTTAAAATAAAATTTT
TTTCTCATAATATTTCTAAAAATAATAGGCTCATGTTACATTCGGAATAGTTGTAGGTTT
AATGGCATTTATAATTTAGCAGATATTAGGTTAAATTCTCTAAAAGTTAAATTCTTATAA
CAAATTGATTTGCAGTACTATCAAATACATTATTATTTTTGGTATAGTTGGAGGATTGTA
CTATGTAATAATTAAGTCTATGGTTGACCAAATAAATTCAAAACAAGTTAGCCAAAGCAA
TTTAATTGCTCTAACTTACCTAGTTTGCTTTGCTTTTGATTAAATTTTCATTTAATCAAT
AGTTGTTATATTTAAACACTTTAAGAAATCCTAATAAATTTATAATCTTTCATAGTTAAA
ATGA