Identifiers and Description

Gene Model Identifier

TTHERM_00047400

Standard Name

CVP1 (Fusion of subtilisin-like proprotein and teneurin-1.)

Aliases

PreTt11219 | 3.m01892 | 3824.m02978

Description

Fusion of subtilisin-like proprotein and teneurin-1.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 87.1%

TetraMine Data

TTHERM_00047400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01709.19.997093137033517e-262hypothetical protein (4064 aa)
OxytrichaContig18862.0.g771.999683289470905e-41hypothetical protein
Stentor CoeruleusSteCoe_214861.0806392777072785e-30
WormBaseWBGene000022990.00000000039982266684865623locus:let-23 status:Confirme
d UniProt:B5BM28 protein_i
d:CAR31510.1
DictyBaseDDB_G02756590.000000000500206551404915DDB_G0275659 on chromosome: 2
position 5815544 to 5818897

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047400(coding)
ATGAGAATTATTATAGTGTTAATATCGTTATTTATAATTTAAATAATTAAAGCTGTAGAA
TAAAATTATGAAGACTAACAGTTTTCTTTCTCTCCTTTAATTTAATAATTTGATATAAAC
TAAGTATAGTTTTACTCTAAAGCCTTCGAAAATCATATTAAGATCTTTTGTTTGTTTGAG
CCAACTTTAATTTAATCTAGACATTTTGTTTTCCATTTTAGCTTTTAACTTAAATCTAAA
TTAAATAAGAAAATAAGATGGATAATGGTGTATTTAGATCAAGCTATTTAGTCAGGAATA
ATTGAAGAATAAGGAATATAAATATTTTAACTAAGTACTAAATACAAATCAAACTAAAAT
ACAATTTTATCAGATCACCTCAAATAAATCGAAATGACTTTTTTTATTGATGAACAAGAA
ATTAATCCAACTACTTTAGTTGGTTAATTTGAATTTTTATACTTGCATATTAGAGAAAAT
TATGAAACTACTAGTAAAAAGTTTAGACTGTTGTAAACAAAAGTGTCTGGAGCTTGCTCT
ATAGGTTAATTTAAAAATAAAGATAGTACTTGCGGTACTTGTACATCAAATTGCAATTTC
TGCTCAGATAGTGGTTCTAGTAGTTGCTTTGTTTGCAAAGATACTTATTACTAATCAGGA
ACTAATGACTTTTTTAGAGTAAAAGGATCCTGTTCCAATGGATCTTCAGGTTGTGGTTCT
TATCATACCAAACTTAGTGGTAAATGTTGTCTTTACAATTGCAAAAGTTGTGACTAATAC
GATAAATGCTTAACTGCAGGTACTAATTAAATTTTTAACTATAAAAATAATGACCTGTAA
ACAAAATCAGGTGTTTGTCTAAGTTCTGTTAATTTATATAACGCTGCTTGCGTTTGCGCT
CCTGGATAATATAATAATAGTGCTAGCTCTATTACTTGCTCTGCTTGTCCTACTAACTGC
AACAGGTGTGGAAAGCCTTCAAGTACAATTATATGTGTTATATGCAAGTCAGGATACTAT
TTATCTTCATCAGGAAATTGTGTTCAATGTGGACCAAACACATTTACATAATATTTATTA
AGGGATGATCTTGCAGATGAAGGTAATCCTTTTTCTTATTGCTTAGACTGCGACTCTTCT
TGCAATGGATGTACTAATTATGATTAATATAGTTGTATTGATTGCAAAGCAGGGTGGTAT
AAATTTGTTTAATTGGATGGTAAAACAATATGCATGGATTGTTAAGCTAGTTTAGGATAT
TTTGTGAAAGGCGGTCAGTGTTATCAATGCGGACCTAACTGCTAAGCTTGTAATCAAAAT
TTAGTATCAGAATGTACAAACTGTTTGTCTGGTTTCTATCTTAAAGTTGATACAAAAACA
TGTGATCCCTGCAATTTAGATTATTACTATAAATCTGCGAGTCAATGTCTTAAATGTGTT
GATAAGTGTAAAACCTGTACTTCAGGAACATCTTGCACTTTATGTGATACAGGATTTTTT
GTAAAAGGAGGCAATACTTGTGATCTATGTAGCTCAAATACAGGTTTTTATTAAGATGTT
CCTAACAATAAATGCTTAGCATGTGCATAATTTTGTCTAAATTGTACTGGTGGTTAACCA
TAAAACTGTACTTAATGTTAAACAGGCTACTATAAATATGATAATAATACAGAAAACAAT
CCTGCTGATGATTATTGTATTGACTGTAATTTATCTGGTGGATATTTTCTTGATGGTACT
ACATGCAGAAAATGTTTAGCTAATTGTTAAAAATGTTCTAATAAATTAACCTGTGATCTT
TGTAATACAGGTTTTTATGTAGACCAAACTACTGGTACGTGTATATCTACATGCGATTCT
CAAGGAAATTATATATGGAACGGAACTCATTGCAAAAAATGTGATCCTGACTGTCAGACA
TGCAAAGGAGGTGCAAAAACAGATTGCATTAACTGTGCCCCCTCTAAATATAAATTCGAT
TAAAATAACACTCCAGGTGATACAAGCGATGACATATGTGTAAAGTGTGATCAACTTTAA
TAATTTGTTGATATTGATAATATATGTAAAAGATGCGATCCTACATGCTAAACATGTAAC
AGCACTGCAAATACAGGATGCATTAAATGCTAATCAGGTTTAAGCAAGAGAAATAATGTT
TGTCTGAATTGTTCAACCATTTAAAGTACCTATGTTGATATCGACCAATGCAAAGATTGT
GATCCTTCTTGTAAATCTTGCTCAAAAGCAGGAAATTAATGTGATGTTTGCAAATCTGGT
TTTTCTAGACAATCAAATAGTTGCATAGATTGCTCAAAACTTTCAAATTATTATGTAGAT
TTCACAATTAATAAAACAGAAGGAGAATGCAAGTAATGTGATTCATCTTGTGCAACTTGT
TCTGACGGAACCCCTACTGGCTGTAAAACCTGTGCAAGTGGAAAATATAGATTAGGCAAC
TTATGTGTTAGTTGTAATCTAGATAAATAATTAAAGAATGATAATACCTAAACCTGTGAT
TCTTGCGATTCTTCATGTAAAACATGCTCTGACATAACATAGACAGGTTGTATACTCTGC
GACGATTCTAAATATAAACTTAGTAATCTATGTATAGACTGCACTTAAGATAAGTATTTT
AAAAATGCATAAACAAAAACTTGTGATAAATGCTTTCAGTCTTGCAAAACTTGTTCAGAT
GCTCAAGAAACAAGCTGCTTATAATGTGATACTAATTTTTATAGGTTAGATAATAAATGC
GTAACTTGTACATAAGATAAGTATTTTTAAAATTAATCAACTTAGACATGCGATTAATGC
CATCCATCATGTAAATAATGCTCAGGTTCTTCTGAAACTGAATGCTTGAAATGCGAAGTT
GGATATTATAAGTTAGGAAATAAATGTGTTTAGTGCAATTAAGATAAATATTTTAAAAAT
GAAAACACATAGACTTGTGATTAATGCCATTCTTCCTGCAAAACTTGTAGTGACTCAACT
AATCTTGGTTGTTTAGTTTGTGATGATGCCATGAAAAGATATTAAGATGGTACTTGCTAA
GTATGTGATCCAGCTAATTCACCCTATTTTATATCAGGTAATAATTGCTTAAAATGCGAT
TCTTCCTGCTTAACATGTACTGGTGATAAAGATACCTAATGTACTTAGTGCAGTAATCCT
GCATATAAAATAAGAGAAGTAGTAAATTAATGTATGCCATGTCCTGATAGTTACTTTTCG
ATAAATAATTATTGTTACAAATGTCATTCTTCCTGCGAAACATGTTAAGGTTCTAATGAT
GATAAAAGCTGTACTAAATGTAAAGCAGGATTTAATTTCCATTAAGATAATACATGTAGT
GAATGTTTAGTAAATAATAAATTTTACATCGATGCTAATGATAATGTATGCAAAAGTTGC
GACTCCACTTGCTTGACATGTACAGGACCTAGTAAATTCGAATGCAAAAATTGTGATGGA
ACATTAAAAAAGCTCAAAGATAATACTTGTGTTGATTGTCCATTAATAGGATTCTATGTA
AACGGTGAAAGATGCTACAAATGTGATTCCACATGTAAAACTTGTGATGGTGAAAATGAT
ACTAGTTGCACTCAATGCTAAGATAATTTATATAAATTTATTGATGACGGAAAATGCAAG
ACTTGTAACAAAGAAGATAAACTATATATCGACACTCAAGATAATAATATTTGTAAGCAC
TGTCATACTACTTGTAAGGAATGCTAAAATGGAACAGATAAAGGCTGTACTATTTGTAAT
GATAACCTTTATAAAATGAAAGATTAAACCTGTTAAACCTGTCCTGATCAACACTTTTTC
AAATAAGGAGAGTTTTGTATGGAATGTGATTAATCTTGCCTCACATGCTCAGATAGCACT
AGCAAATGTAGCAAATGCGACAATACTAAAGGTTACTATTTTGAAGAAAATAATTACTGT
AAAATATGTGAAATTGATAAGTCTTTTTATATTTCTGGTGAATTTTGCAAACCTTGTTTC
TCAAATTGCGGTACATGCTTAGGCGGCTTATCTACTGAATGTAAAACTTGTTTAAATCCT
ACTGAAAAAATGATGCCTGATAATAGCTGCAAGGTTTGTCCAACTGATAATTATTTTATA
CAAGGAGATAGATGTGTCCCATGTGATCAAACTTGTAAATAATGTCATGGTGCTTCTGCA
AATGAATGCACACTATGCTAGAATGGATAGTATTTATTTAAAGATAATTCTTGTGCCACA
TGCCCTAGTGAAGGTTATTTTATAAAGGATATTAATTGTTTTTAATGTAGTTAAAATTGT
AAAACTTGTACAAATGAAAATAATGATGGTTGCTAGTAATGTATGGGAAGTAAAAAATTA
GATAAAAATAATGTTTGTATAGATTGCCCAATAACTGAATTTTACTAAACACCTACTTAA
TGTCTTGAATGCCATTAAAATTGTCTCACATGTACTAATGGAGACTCTACAAGTTGTTTA
ACTTGCAAAACTGGATTTAGAAAAATGTTAGATGGTAGTTGTCAAACATGTCCCTTAACT
AATTTTTATGATGATGGAATTAATTGTACTCCATGTCATCCCTCATGTGAAGTTTGTAAA
GGACTTACAGAAAATGATTGTTTAAATTGTCCAAGTGGCAAATATTTTATGCCAGATAAA
ACTTGCAAAGTATGCCCAGTAAATAATCAATTTTACATAGATGGCTTATAGTGTGTACCT
TGTTTTGAAGGCACATGCTAAACCTGCTTCGGAAAGGAAAAAAATTAATGTTCAACATGT
TAATCAGGACTCTATTTATATCCAGATAATTAATGTGGAAGTTGTAGTGAAAATTATTAT
TTCAGGGATGATCAAAATAAGCTATGTAAGAAGTGTGATCCATCTTGTATGACTTGCCAT
GGAGTACTTGATACTGAATGTGATTTATGTGACACAAATAAATATAAATATCCTGATTAG
AAATGCAGAGAATGTGATATAAATAATAAAAAATTTATTTCGCAAACAAATATATGCTTA
GATTGTGATAGTTCTTGTAAGACTTGCAACAACGAATAGCCAGATTAATGTAAATCATGT
GAAAGTAATTTATATTTTAAAGATAGTTTATGTTAAGTTTGCCCAGATGAGCACTTCTTC
ATTTAAGGGACTTAGTGTTTGAAATGTGATAGTACATGCTTAAAATGTTCAAATAGTAAA
GCAACAGATTGCATATCTTGTGTTAATAATACCTTTATTAATGAGGATTCTTAACTTTGT
AAACCATGTGATACTACTAATAAATATTTTTAAGATGGATTTTATTGTAGAAAGTGTCTT
CCTTCATGCAAAACTTGTAATGACACTAGCAAATGTTTAACATGTGATGATGGTTTGTCC
TTTATGGAAGATGGTACTTGCAAAGTATGCAATACTGATCATGGCTTCTATATAGAAGCC
AGTACTAACACTTGTAAAAAATGCATTTAAAACTGTTTAAAATGTTCAAGTTTAACTTCA
TGTGATGTTTGTTAAAGTGGATTTATTTTAAGAATAGATGGATCATGTGGTAACTGTGAT
TCAAACCAATATGCTGATTAAAATTAAAAATGCTAAAACTGTCATTCATCTTGTGCCACA
TGTAATGGTCCAGATGCAACGAATTGTTTAAGTTGTTCAAATAATTAATTATTTATCAGA
TTAGATACTAAACTATGTGACAAATGTGACTCTAACTAATATGTTGATGGAAATAAATGT
GCTAATTGCCATTCTGATTGCGCTACTTGTTCAGGTCCTCTTGATAAAGATTGCAAAACA
TGCTCTAGCAGCTCAAAATAATTTTGTGATAATGCAAAAGTTGTGGCATTTGGAAAACAG
AATAATAACCCATCTTTAACTTGTGAAAAATCTTGTTTAACTTGTAACTCAACATGCAAA
ACTTGTTTTTCTTCTACTGCTTAAGGATGTATGGATTGCTCTATAGGAACACTCAAGACA
GATTTTTCATGCTCTGTTTGTGGTAATGGAGAATATTTAGACTCATAAGCTAAAACATGC
AGGAAATGTTCTGTTAATTGTAATCAATGCACAGGGTTAAATTAATGTACTCAGTGCAAA
GATGGATATACAAATGTATCTGGTAAATGCTACTCGTGCCCTCCTGGATAATTTGTTGAT
GTAGATACAAAATGTAAGTAATGCCACTCCGATTGCAAGACATGTATTAATAAGAATAAT
ACTGACTGCTTAGTTTGCAGTGATTCTAGCAAATTTTTAAATTAAAATAATTTATGTGTT
GATAAATGCGATCTTGGATATATTAGGCACACAGTTTTAAATAAATGTGTTAGATGCTAA
TATAAAATGATAAACGGTAATTTAGAATGTCTTGAAGAGTGTCCTGACTAAAGTGGATGT
TCTATTACTTGCTTAGACAATTCTTTTAAATTAAATGATTAATAATGCTAATGCAACTAA
AATTATTAGTTTATTTAAAATTCTGTTAACAAATGTGAGATCTAATGTGGAAAAAATGCA
ATAAAAGTTGATTAAAATACATGCCAGTGTTAGGATTTTACTTATGAATTTGTTCCTTTA
TCTAAAACAACCTGCCGTGTCAAGTGTGGACTTAATGCAGCTAATGTAGATGAAAATACT
TGTGCTTGTAAAAATGGCTTTTCATTCAAGCCATCTACAAACAATACTGTTTGTTAGATT
GATTGTGGGTTGAGTGCTTTTAGAGTAGATGAAAATACTTGTTAATGCAATCCAAATTAC
AAATTTACTACTGGTTCAAAAATAAATTGTGAAATAATTTGTGGTTTCAAGGCTTCTCAA
ATTGATAGCTAAACCTGCGGCTGCGAGAAAGGTTATTCTCTTGTACCTTCATCAAAGACA
GAATGCTAAATAGACTGCTTAGATAATACTGACAGAGTAGATAATAATACTTGCAAGTGT
AAGTCAGGTTATAGCTTTGTTTAAAACTCTTATGTTTAGTGTTAAATTAATTGTGGTCTT
TTTGCTTAGAATAATGATATTAATACTTGTAAATGTCTTTAAGGGTACGAGTATCAGGCT
AATTCTTAAATAGATTGCTAGCTAAAATGTTTAGATAATTCAGCCAGAGTTGATGCTTCG
ACCTGTAAATGCAATGATGGATTTGAATTTGTTAAAGATTCAAATTCTCAATGTCAAAAA
AAATGTGGTAATTACGCAAAAAACAAAGATTTACTTACTTGTTAATGTCAGGATGGTTAT
GAATTTGTATTAGGCAGTAGTACAGATTGTATGATAACATGCGGTAAACATGCATCAAGA
TTAAACAATGATACTTGTACTTGCGATACAGGTTATCAATTTGTTTAAAATTCCTAAAGA
GAATGTTAAATTACTTGTGGAAGAAATGCATCTAATAAAGATTAAGATACATGTATCTGC
AAGAACGAATTTTAATTTGAATAGAATTCAAATACTGATTGTGAAATAGTGTGTGGTGTT
AATTCCTCACCTCTTACAAAAGATTTATGTCAGTGCAACTCAGGTTATGAACTTGCACCT
AATTCTTTAGCAAACTGCTAATTAAAATGTGGTGCTAATGCTATAAATAAAGGATATGAT
CAATGTGTCTGTAAAACTGGATTTTAGTATCAAAGTGGTTCATAGATTGCTTGTGAAATT
ACTTGTTTAGATAATGCATTAAGAATAGATGCAAATACTTGCTAATGCAACTCTGGTTAT
GAATTTATTCCTAATTCTTAAGTTTAATGCAGAATAAAATGTGGTAATAAAGCAATTAAT
AAAGATCTTAATACTTGCCAATGCTTACCAGATTTTTAATTTTCGTAAGGATCGTCAATA
AGCTGTGAAATATAATGTGGAGCTTTTGCAAAATAGATAGATTTAAACACCTGCTAATGT
GTTAAAAGTACTTTTGCTTTTATTCCAGGATCATAAACTGCTTGCTAGCTTTCCTGTGGT
AATAACGCTTTAAATCATCCAACTAAAAATGACGAATGTATATGTAAAGAAAACTTTTAA
TTTGAATAAGGTTCAGAAACTAATTGTGAAATAGTATGTCAAAATAATGCTAAATAGAAA
AATAAAAATGAATGCTCTTGTACAAAACAAGGTTATGAATTTTATCCTGGATCTATAGTC
AAATGCAGAAAAAGATGTGGGGATAATGCCATATAATTTGATGAAAATAATTGTCAATGT
CCATAAGACTTCTAATTTGTTAATGGTTCTGACTCAGATTGCGAAATAAAATGTGGAAAA
AATGCTAATAGGATAAGCTCAAAATAATGCTAATGTATAGACAAATTTGATTTTATAGAA
AACTCTATTACAGATTGTAGAATTAAATGTGGTTATAAATCAGTTAATTTAGATGATCAT
AATTGTACCTGCGAAAAAGGATATTATGCCCAACCTGGATCTTTGACTGAGTGTTAACGT
TTTTGTGGACCACACTAAGTGAATTAAGACAGAGAGAACTGTATTTGTGAAAAAGGATTT
GAGGCTGTACCAGGTGTTGCACCACTTGAATGTAGCATAGTTTGTGGACACAAATCTGTA
AAGGAATCATAATTTAAGTGCAAATGCGAAAATGGATATTAATTAAAAGAAGGTTCTCTT
TCTGAATGCAGCGTTAAATGTGGGTAAAATGCTATTAATGACAAAAATAATAATGACATT
TGTGTATGTAAGGATGAGAATTATTAATTTATTATAAACTCAAATATTGATTGTGAGTTT
AAACCATATCAAGAAGCATCATTCAGTGCATCTAACTTAAAGTACTATAGTTCTTTTTAT
ATTATAACTGGCTTGTCATTTTTTTCTTTTGGTTTGCTTTTGGTTGCTTGGAAATTAGAT
GCCAGGGATATGCTCCGAGTTATTCCTTCGAAATCACATTTGCCAACTTTTTTCCTTGAA
ACTTCATAAATAAAAGTTTCACATCTAGTAAATTTTAGCAACTAGCCTAGTAATATAAGA
AACGATGATGAAAAAGCTCAAAATAATTAATATAAAAGAAAATAGCATATTTCAACTATC
CTTAATGCTACTATAACAATGAATCATGACTAAACAGCTCCACTTGATTTTTCAGATTTT
GATAAAGCACAAGAAGCAAAAAACGCTACTACTATTTAATAATTAAACATTACTATTGAT
AACTAAGAAGCCACTAAAAATTAACTTGATTTTAGTGATTTCGACAATAATCCTGAAATG
TAGAAAAAAATAAATGATAGTAAAATTTATGTAAGTACTAAATAGAATTCCTCAATTTTA
ATGAATAATTTAAATTCTTCTGTTTTAAACAATACCAGTTAATTATAATTAGACTAATAA
AATGTGTTAGATTTGAACTAATCAGCAATAGCTTAATCTCCTAATTAAAAGCATATGAAA
CTATCATCACCTGATCAACTAAAAACAAAAGCTACTCCTGTTTTAAACACATCAACTCCT
TTCCCTTATACATAAAAATCTAAAACTGAAAAAGGAACATCATTATTTGCAATTATTTGG
TTTAATCATGAATTTGTTAGTATATGGACTCGCTATGATAAAGATTTATCTAGATCTTTA
AGATCTTTCTTAATCCACTTGAAATAGATATTCTAAATAGGGATAATATCACTCTTACCA
ATTTAATAGATTGGAATAGGAATTGTAACAGCATTTGCAAGTTCTATTGTATTCTTGGCT
ATTAAAAAACTCATAAAATTATATGGAAGTACTAAAAGTTTAGTGGCAAGAATCTTAAAA
TATAGTATTTTATTATCTTTATCAGGCTTACTTTATTTAGCCAGTATCTAAAAACTCATC
GACTAAACCTCTCATAAAGACTCTTTTGGTAGCCATATGATATCCTTAGCATTTCTTTTA
AGTACTGGATTAGATTAAATAGTAATCCAACCTATAATAGCTTTAATTTCTTATAAAATG
CAAATGAATAAAGTATTTGATCTAAGCCCAACTAAAATATGA


>TTHERM_00047400(protein)
MRIIIVLISLFIIQIIKAVEQNYEDQQFSFSPLIQQFDINQVQFYSKAFENHIKIFCLFE
PTLIQSRHFVFHFSFQLKSKLNKKIRWIMVYLDQAIQSGIIEEQGIQIFQLSTKYKSNQN
TILSDHLKQIEMTFFIDEQEINPTTLVGQFEFLYLHIRENYETTSKKFRLLQTKVSGACS
IGQFKNKDSTCGTCTSNCNFCSDSGSSSCFVCKDTYYQSGTNDFFRVKGSCSNGSSGCGS
YHTKLSGKCCLYNCKSCDQYDKCLTAGTNQIFNYKNNDLQTKSGVCLSSVNLYNAACVCA
PGQYNNSASSITCSACPTNCNRCGKPSSTIICVICKSGYYLSSSGNCVQCGPNTFTQYLL
RDDLADEGNPFSYCLDCDSSCNGCTNYDQYSCIDCKAGWYKFVQLDGKTICMDCQASLGY
FVKGGQCYQCGPNCQACNQNLVSECTNCLSGFYLKVDTKTCDPCNLDYYYKSASQCLKCV
DKCKTCTSGTSCTLCDTGFFVKGGNTCDLCSSNTGFYQDVPNNKCLACAQFCLNCTGGQP
QNCTQCQTGYYKYDNNTENNPADDYCIDCNLSGGYFLDGTTCRKCLANCQKCSNKLTCDL
CNTGFYVDQTTGTCISTCDSQGNYIWNGTHCKKCDPDCQTCKGGAKTDCINCAPSKYKFD
QNNTPGDTSDDICVKCDQLQQFVDIDNICKRCDPTCQTCNSTANTGCIKCQSGLSKRNNV
CLNCSTIQSTYVDIDQCKDCDPSCKSCSKAGNQCDVCKSGFSRQSNSCIDCSKLSNYYVD
FTINKTEGECKQCDSSCATCSDGTPTGCKTCASGKYRLGNLCVSCNLDKQLKNDNTQTCD
SCDSSCKTCSDITQTGCILCDDSKYKLSNLCIDCTQDKYFKNAQTKTCDKCFQSCKTCSD
AQETSCLQCDTNFYRLDNKCVTCTQDKYFQNQSTQTCDQCHPSCKQCSGSSETECLKCEV
GYYKLGNKCVQCNQDKYFKNENTQTCDQCHSSCKTCSDSTNLGCLVCDDAMKRYQDGTCQ
VCDPANSPYFISGNNCLKCDSSCLTCTGDKDTQCTQCSNPAYKIREVVNQCMPCPDSYFS
INNYCYKCHSSCETCQGSNDDKSCTKCKAGFNFHQDNTCSECLVNNKFYIDANDNVCKSC
DSTCLTCTGPSKFECKNCDGTLKKLKDNTCVDCPLIGFYVNGERCYKCDSTCKTCDGEND
TSCTQCQDNLYKFIDDGKCKTCNKEDKLYIDTQDNNICKHCHTTCKECQNGTDKGCTICN
DNLYKMKDQTCQTCPDQHFFKQGEFCMECDQSCLTCSDSTSKCSKCDNTKGYYFEENNYC
KICEIDKSFYISGEFCKPCFSNCGTCLGGLSTECKTCLNPTEKMMPDNSCKVCPTDNYFI
QGDRCVPCDQTCKQCHGASANECTLCQNGQYLFKDNSCATCPSEGYFIKDINCFQCSQNC
KTCTNENNDGCQQCMGSKKLDKNNVCIDCPITEFYQTPTQCLECHQNCLTCTNGDSTSCL
TCKTGFRKMLDGSCQTCPLTNFYDDGINCTPCHPSCEVCKGLTENDCLNCPSGKYFMPDK
TCKVCPVNNQFYIDGLQCVPCFEGTCQTCFGKEKNQCSTCQSGLYLYPDNQCGSCSENYY
FRDDQNKLCKKCDPSCMTCHGVLDTECDLCDTNKYKYPDQKCRECDINNKKFISQTNICL
DCDSSCKTCNNEQPDQCKSCESNLYFKDSLCQVCPDEHFFIQGTQCLKCDSTCLKCSNSK
ATDCISCVNNTFINEDSQLCKPCDTTNKYFQDGFYCRKCLPSCKTCNDTSKCLTCDDGLS
FMEDGTCKVCNTDHGFYIEASTNTCKKCIQNCLKCSSLTSCDVCQSGFILRIDGSCGNCD
SNQYADQNQKCQNCHSSCATCNGPDATNCLSCSNNQLFIRLDTKLCDKCDSNQYVDGNKC
ANCHSDCATCSGPLDKDCKTCSSSSKQFCDNAKVVAFGKQNNNPSLTCEKSCLTCNSTCK
TCFSSTAQGCMDCSIGTLKTDFSCSVCGNGEYLDSQAKTCRKCSVNCNQCTGLNQCTQCK
DGYTNVSGKCYSCPPGQFVDVDTKCKQCHSDCKTCINKNNTDCLVCSDSSKFLNQNNLCV
DKCDLGYIRHTVLNKCVRCQYKMINGNLECLEECPDQSGCSITCLDNSFKLNDQQCQCNQ
NYQFIQNSVNKCEIQCGKNAIKVDQNTCQCQDFTYEFVPLSKTTCRVKCGLNAANVDENT
CACKNGFSFKPSTNNTVCQIDCGLSAFRVDENTCQCNPNYKFTTGSKINCEIICGFKASQ
IDSQTCGCEKGYSLVPSSKTECQIDCLDNTDRVDNNTCKCKSGYSFVQNSYVQCQINCGL
FAQNNDINTCKCLQGYEYQANSQIDCQLKCLDNSARVDASTCKCNDGFEFVKDSNSQCQK
KCGNYAKNKDLLTCQCQDGYEFVLGSSTDCMITCGKHASRLNNDTCTCDTGYQFVQNSQR
ECQITCGRNASNKDQDTCICKNEFQFEQNSNTDCEIVCGVNSSPLTKDLCQCNSGYELAP
NSLANCQLKCGANAINKGYDQCVCKTGFQYQSGSQIACEITCLDNALRIDANTCQCNSGY
EFIPNSQVQCRIKCGNKAINKDLNTCQCLPDFQFSQGSSISCEIQCGAFAKQIDLNTCQC
VKSTFAFIPGSQTACQLSCGNNALNHPTKNDECICKENFQFEQGSETNCEIVCQNNAKQK
NKNECSCTKQGYEFYPGSIVKCRKRCGDNAIQFDENNCQCPQDFQFVNGSDSDCEIKCGK
NANRISSKQCQCIDKFDFIENSITDCRIKCGYKSVNLDDHNCTCEKGYYAQPGSLTECQR
FCGPHQVNQDRENCICEKGFEAVPGVAPLECSIVCGHKSVKESQFKCKCENGYQLKEGSL
SECSVKCGQNAINDKNNNDICVCKDENYQFIINSNIDCEFKPYQEASFSASNLKYYSSFY
IITGLSFFSFGLLLVAWKLDARDMLRVIPSKSHLPTFFLETSQIKVSHLVNFSNQPSNIR
NDDEKAQNNQYKRKQHISTILNATITMNHDQTAPLDFSDFDKAQEAKNATTIQQLNITID
NQEATKNQLDFSDFDNNPEMQKKINDSKIYVSTKQNSSILMNNLNSSVLNNTSQLQLDQQ
NVLDLNQSAIAQSPNQKHMKLSSPDQLKTKATPVLNTSTPFPYTQKSKTEKGTSLFAIIW
FNHEFVSIWTRYDKDLSRSLRSFLIHLKQIFQIGIISLLPIQQIGIGIVTAFASSIVFLA
IKKLIKLYGSTKSLVARILKYSILLSLSGLLYLASIQKLIDQTSHKDSFGSHMISLAFLL
STGLDQIVIQPIIALISYKMQMNKVFDLSPTKI


>TTHERM_00047400(gene)
ATGAGAATTATTATAGTGTTAATATCGTTATTTATAATTTAAATAATTAAAGGTATCATT
AAATATTTAAGTAAATATATTTCAATATCCAAACTCTTTTATAAAAAAAGCTGTAGAATA
AAATTATGAAGACTAACAGTTTTCTTTCTCTCCTTTAATTTAATAATTTGATATAAACTA
AGTATAGTTTTACTCTAAAGCCTTCGAAAATCATATTAAGATCTTTTGTTTGTTTGAGCC
AACTTTAATTTAATCTAGACATTTTGTTTTCCATTTTAGCTTTTAACTTAAATCTAAGTA
ATTTATTATTATTAATTATTTATATCGTGGATTAATTTATTTTTGAAAAGATTAAATAAG
AAAATAAGATGGATAATGGTGTATTTAGATCAAGCTATTTAGTCAGGAATAATTGAAGAA
TAAGGAATATAAATATTTTAACTAAGTACTAAATACAAATCAAACTAAAATACAATTTTA
TCAGATCACCTCAAATAAATCGAAATGACTTTTTTTATTGATGAACAAGAAATTAATCCA
ACTACTTTAGTTGGTTAATTTGAATTTTTATAGTAAATTTCTTATAATCATAAAAAAATA
TTCATTCTTAAAAAAGAATTTAAATATTAAATTTACTAAAATTTAACTTAATAAAATAAA
AAGCTTGCATATTAGAGAAAATTATGAAACTACTAGTAAAAAGTTTAGACTGTTGTAAAC
AAAAGTGTCTGGAGCTTGCTCTATAGGTTAATTTAAAAATAAAGATAGTACTTGCGGTAC
TTGTACATCAAATTGCAATTTCTGCTCAGATAGTGGTTCTAGTAGTTGCTTTGTTTGCAA
AGATACTTATTACTAATCAGGAACTAATGACTTTTTTAGAGTAAAAGGATCCTGTTCCAA
TGGATCTTCAGGTTGTGGTTCTTATCATACCAAACTTAGTGGTAAATGTTGTCTTTACAA
TTGCAAAAGTTGTGACTAATACGATAAATGCTTAACTGCAGGTACTAATTAAATTTTTAA
CTATAAAAATAATGACCTGTAAACAAAATCAGGTGTTTGTCTAAGTTCTGTTAATTTATA
TAACGCTGCTTGCGTTTGCGCTCCTGGATAATATAATAATAGTGCTAGCTCTATTACTTG
CTCTGCTTGTCCTACTAACTGCAACAGGTGTGGAAAGCCTTCAAGTACAATTATATGTGT
TATATGCAAGTCAGGATACTATTTATCTTCATCAGGAAATTGTGTTCAATGTGGACCAAA
CACATTTACATAATATTTATTAAGGGATGATCTTGCAGATGAAGGTAATCCTTTTTCTTA
TTGCTTAGACTGCGACTCTTCTTGCAATGGATGTACTAATTATGATTAATATAGTTGTAT
TGATTGCAAAGCAGGGTGGTATAAATTTGTTTAATTGGATGGTAAAACAATATGCATGGA
TTGTTAAGCTAGTTTAGGATATTTTGTGAAAGGCGGTCAGTGTTATCAATGCGGACCTAA
CTGCTAAGCTTGTAATCAAAATTTAGTATCAGAATGTACAAACTGTTTGTCTGGTTTCTA
TCTTAAAGTTGATACAAAAACATGTGATCCCTGCAATTTAGATTATTACTATAAATCTGC
GAGTCAATGTCTTAAATGTGTTGATAAGTGTAAAACCTGTACTTCAGGAACATCTTGCAC
TTTATGTGATACAGGATTTTTTGTAAAAGGAGGCAATACTTGTGATCTATGTAGCTCAAA
TACAGGTTTTTATTAAGATGTTCCTAACAATAAATGCTTAGCATGTGCATAATTTTGTCT
AAATTGTACTGGTGGTTAACCATAAAACTGTACTTAATGTTAAACAGGCTACTATAAATA
TGATAATAATACAGAAAACAATCCTGCTGATGATTATTGTATTGACTGTAATTTATCTGG
TGGATATTTTCTTGATGGTACTACATGCAGAAAATGTTTAGCTAATTGTTAAAAATGTTC
TAATAAATTAACCTGTGATCTTTGTAATACAGGTTTTTATGTAGACCAAACTACTGGTAC
GTGTATATCTACATGCGATTCTCAAGGAAATTATATATGGAACGGAACTCATTGCAAAAA
ATGTGATCCTGACTGTCAGACATGCAAAGGAGGTGCAAAAACAGATTGCATTAACTGTGC
CCCCTCTAAATATAAATTCGATTAAAATAACACTCCAGGTGATACAAGCGATGACATATG
TGTAAAGTGTGATCAACTTTAATAATTTGTTGATATTGATAATATATGTAAAAGATGCGA
TCCTACATGCTAAACATGTAACAGCACTGCAAATACAGGATGCATTAAATGCTAATCAGG
TTTAAGCAAGAGAAATAATGTTTGTCTGAATTGTTCAACCATTTAAAGTACCTATGTTGA
TATCGACCAATGCAAAGATTGTGATCCTTCTTGTAAATCTTGCTCAAAAGCAGGAAATTA
ATGTGATGTTTGCAAATCTGGTTTTTCTAGACAATCAAATAGTTGCATAGATTGCTCAAA
ACTTTCAAATTATTATGTAGATTTCACAATTAATAAAACAGAAGGAGAATGCAAGTAATG
TGATTCATCTTGTGCAACTTGTTCTGACGGAACCCCTACTGGCTGTAAAACCTGTGCAAG
TGGAAAATATAGATTAGGCAACTTATGTGTTAGTTGTAATCTAGATAAATAATTAAAGAA
TGATAATACCTAAACCTGTGATTCTTGCGATTCTTCATGTAAAACATGCTCTGACATAAC
ATAGACAGGTTGTATACTCTGCGACGATTCTAAATATAAACTTAGTAATCTATGTATAGA
CTGCACTTAAGATAAGTATTTTAAAAATGCATAAACAAAAACTTGTGATAAATGCTTTCA
GTCTTGCAAAACTTGTTCAGATGCTCAAGAAACAAGCTGCTTATAATGTGATACTAATTT
TTATAGGTTAGATAATAAATGCGTAACTTGTACATAAGATAAGTATTTTTAAAATTAATC
AACTTAGACATGCGATTAATGCCATCCATCATGTAAATAATGCTCAGGTTCTTCTGAAAC
TGAATGCTTGAAATGCGAAGTTGGATATTATAAGTTAGGAAATAAATGTGTTTAGTGCAA
TTAAGATAAATATTTTAAAAATGAAAACACATAGACTTGTGATTAATGCCATTCTTCCTG
CAAAACTTGTAGTGACTCAACTAATCTTGGTTGTTTAGTTTGTGATGATGCCATGAAAAG
ATATTAAGATGGTACTTGCTAAGTATGTGATCCAGCTAATTCACCCTATTTTATATCAGG
TAATAATTGCTTAAAATGCGATTCTTCCTGCTTAACATGTACTGGTGATAAAGATACCTA
ATGTACTTAGTGCAGTAATCCTGCATATAAAATAAGAGAAGTAGTAAATTAATGTATGCC
ATGTCCTGATAGTTACTTTTCGATAAATAATTATTGTTACAAATGTCATTCTTCCTGCGA
AACATGTTAAGGTTCTAATGATGATAAAAGCTGTACTAAATGTAAAGCAGGATTTAATTT
CCATTAAGATAATACATGTAGTGAATGTTTAGTAAATAATAAATTTTACATCGATGCTAA
TGATAATGTATGCAAAAGTTGCGACTCCACTTGCTTGACATGTACAGGACCTAGTAAATT
CGAATGCAAAAATTGTGATGGAACATTAAAAAAGCTCAAAGATAATACTTGTGTTGATTG
TCCATTAATAGGATTCTATGTAAACGGTGAAAGATGCTACAAATGTGATTCCACATGTAA
AACTTGTGATGGTGAAAATGATACTAGTTGCACTCAATGCTAAGATAATTTATATAAATT
TATTGATGACGGAAAATGCAAGACTTGTAACAAAGAAGATAAACTATATATCGACACTCA
AGATAATAATATTTGTAAGCACTGTCATACTACTTGTAAGGAATGCTAAAATGGAACAGA
TAAAGGCTGTACTATTTGTAATGATAACCTTTATAAAATGAAAGATTAAACCTGTTAAAC
CTGTCCTGATCAACACTTTTTCAAATAAGGAGAGTTTTGTATGGAATGTGATTAATCTTG
CCTCACATGCTCAGATAGCACTAGCAAATGTAGCAAATGCGACAATACTAAAGGTTACTA
TTTTGAAGAAAATAATTACTGTAAAATATGTGAAATTGATAAGTCTTTTTATATTTCTGG
TGAATTTTGCAAACCTTGTTTCTCAAATTGCGGTACATGCTTAGGCGGCTTATCTACTGA
ATGTAAAACTTGTTTAAATCCTACTGAAAAAATGATGCCTGATAATAGCTGCAAGGTTTG
TCCAACTGATAATTATTTTATACAAGGAGATAGATGTGTCCCATGTGATCAAACTTGTAA
ATAATGTCATGGTGCTTCTGCAAATGAATGCACACTATGCTAGAATGGATAGTATTTATT
TAAAGATAATTCTTGTGCCACATGCCCTAGTGAAGGTTATTTTATAAAGGATATTAATTG
TTTTTAATGTAGTTAAAATTGTAAAACTTGTACAAATGAAAATAATGATGGTTGCTAGTA
ATGTATGGGAAGTAAAAAATTAGATAAAAATAATGTTTGTATAGATTGCCCAATAACTGA
ATTTTACTAAACACCTACTTAATGTCTTGAATGCCATTAAAATTGTCTCACATGTACTAA
TGGAGGTATTTAATTGATTTTATTTTTAAAAATTAAGTTAATTTAATTTTTTATATTAAT
AGACTCTACAAGTTGTTTAACTTGCAAAACTGGATTTAGAAAAATGTTAGATGGTAGTTG
TCAAACATGTCCCTTAACTAATTTTTATGATGATGGAATTAATTGTACTCCATGTCATCC
CTCATGTGAAGTTTGTAAAGGACTTACAGAAAATGATTGTTTAAATTGTCCAAGTGGCAA
ATATTTTATGCCAGATAAAACTTGCAAAGTATGCCCAGTAAATAATCAATTTTACATAGA
TGGCTTATAGTGTGTACCTTGTTTTGAAGGCACATGCTAAACCTGCTTCGGAAAGGAAAA
AAATTAATGTTCAACATGTTAATCAGGACTCTATTTATATCCAGATAATTAATGTGGAAG
TTGTAGTGAAAATTATTATTTCAGGGATGATCAAAATAAGCTATGTAAGAAGTGTGATCC
ATCTTGTATGACTTGCCATGGAGTACTTGATACTGAATGTGATTTATGTGACACAAATAA
ATATAAATATCCTGATTAGAAATGCAGAGAATGTGATATAAATAATAAAAAATTTATTTC
GCAAACAAATATATGCTTAGATTGTGATAGTTCTTGTAAGACTTGCAACAACGAATAGCC
AGATTAATGTAAATCATGTGAAAGTAATTTATATTTTAAAGATAGTTTATGTTAAGTTTG
CCCAGATGAGCACTTCTTCATTTAAGGGACTTAGTGTTTGAAATGTGATAGTACATGCTT
AAAATGTTCAAATAGTAAAGCAACAGATTGCATATCTTGTGTTAATAATACCTTTATTAA
TGAGGATTCTTAACTTTGTAAACCATGTGATACTACTAATAAATATTTTTAAGATGGATT
TTATTGTAGAAAGTGTCTTCCTTCATGCAAAACTTGTAATGACACTAGCAAATGTTTAAC
ATGTGATGATGGTTTGTCCTTTATGGAAGATGGTACTTGCAAAGTATGCAATACTGATCA
TGGCTTCTATATAGAAGCCAGTACTAACACTTGTAAAAAATGCATTTAAAACTGTTTAAA
ATGTTCAAGTTTAACTTCATGTGATGTTTGTTAAAGTGGATTTATTTTAAGAATAGATGG
ATCATGTGGTAACTGTGATTCAAACCAATATGCTGATTAAAATTAAAAATGCTAAAACTG
TCATTCATCTTGTGCCACATGTAATGGTCCAGATGCAACGAATTGTTTAAGTTGTTCAAA
TAATTAATTATTTATCAGATTAGATACTAAACTATGTGACAAATGTGACTCTAACTAATA
TGTTGATGGAAATAAATGTGCTAATTGCCATTCTGATTGCGCTACTTGTTCAGGTCCTCT
TGATAAAGATTGCAAAACATGCTCTAGCAGCTCAAAATAATTTTGTGATAATGCAAAAGT
TGTGGCATTTGGAAAACAGAATAATAACCCATCTTTAACTTGTGAAAAATCTTGTTTAAC
TTGTAACTCAACATGCAAAACTTGTTTTTCTTCTACTGCTTAAGGATGTATGGATTGCTC
TATAGGAACACTCAAGACAGATTTTTCATGCTCTGTTTGTGGTAATGGAGAATATTTAGA
CTCATAAGCTAAAACATGCAGGAAATGTTCTGTTAATTGTAATCAATGCACAGGGTTAAA
TTAATGTACTCAGTGCAAAGATGGATATACAAATGTATCTGGTAAATGCTACTCGTGCCC
TCCTGGATAATTTGTTGGTAATAAACTTTTATATTAATAAAACTAATTTTTAATTAAAAA
TAGATGTAGATACAAAATGTAAGTAATGCCACTCCGATTGCAAGACATGTATTAATAAGA
ATAATACTGACTGCTTAGTTTGCAGTGATTCTAGCAAATTTTTAAATTAAAATAATTTAT
GTGTTGATAAATGCGATCTTGGATATATTAGGCACACAGTTTTAAATAAATGTGTTAGAT
GCTAATATAAAATGATAAACGGTAATTTAGAATGTCTTGAAGAGTGTCCTGACTAAAGTG
GATGTTCTATTACTTGCTTAGACAATTCTTTTAAATTAAATGATTAATAATGCTAATGCA
ACTAAAATTATTAGTTTATTTAAAATTCTGTTAACAAATGTGAGATCTAATGTGGAAAAA
ATGCAATAAAAGTTGATTAAAATACATGCCAGTGTTAGGATTTTACTTATGAATTTGTTC
CTTTATCTAAAACAACCTGCCGTGTCAAGTGTGGACTTAATGCAGCTAATGTAGATGAAA
ATACTTGTGCTTGTAAAAATGGCTTTTCATTCAAGCCATCTACAAACAATACTGTTTGTT
AGATTGATTGTGGGTTGAGTGCTTTTAGAGTAGATGAAAATACTTGTTAATGCAATCCAA
ATTACAAATTTACTACTGGTTCAAAAATAAATTGTGAAATAATTTGTGGTTTCAAGGCTT
CTCAAATTGATAGCTAAACCTGCGGCTGCGAGAAAGGTTATTCTCTTGTACCTTCATCAA
AGACAGAATGCTAAATAGACTGCTTAGATAATACTGACAGAGTAGATAATAATACTTGCA
AGTGTAAGTCAGGTTATAGCTTTGTTTAAAACTCTTATGTTTAGTGTTAAATTAATTGTG
GTCTTTTTGCTTAGAATAATGATATTAATACTTGTAAATGTCTTTAAGGGTACGAGTATC
AGGCTAATTCTTAAATAGATTGCTAGCTAAAATGTTTAGATAATTCAGCCAGAGTTGATG
CTTCGACCTGTAAATGCAATGATGGATTTGAATTTGTTAAAGATTCAAATTCTCAATGTC
AAAAAAAATGTGGTAATTACGCAAAAAACAAAGATTTACTTACTTGTTAATGTCAGGATG
GTTATGAATTTGTATTAGGCAGTAGTACAGATTGTATGATAACATGCGGTAAACATGCAT
CAAGATTAAACAATGATACTTGTACTTGCGATACAGGTTATCAATTTGTTTAAAATTCCT
AAAGAGAATGTTAAATTACTTGTGGAAGAAATGCATCTAATAAAGATTAAGATACATGTA
TCTGCAAGAACGAATTTTAATTTGAATAGAATTCAAATACTGATTGTGAAATAGTGTGTG
GTGTTAATTCCTCACCTCTTACAAAAGATTTATGTCAGTGCAACTCAGGTTATGAACTTG
CACCTAATTCTTTAGCAAACTGCTAATTAAAATGTGGTGCTAATGCTATAAATAAAGGAT
ATGATCAATGTGTCTGTAAAACTGGATTTTAGTATCAAAGTGGTTCATAGATTGCTTGTG
AAATTACTTGTTTAGATAATGCATTAAGAATAGATGCAAATACTTGCTAATGCAACTCTG
GTTATGAATTTATTCCTAATTCTTAAGTTTAATGCAGAATAAAATGTGGTAATAAAGCAA
TTAATAAAGATCTTAATACTTGCCAATGCTTACCAGATTTTTAATTTTCGTAAGGATCGT
CAATAAGCTGTGAAATATAATGTGGAGCTTTTGCAAAATAGATAGATTTAAACACCTGCT
AATGTGTTAAAAGTACTTTTGCTTTTATTCCAGGATCATAAACTGCTTGCTAGCTTTCCT
GTGGTAATAACGCTTTAAATCATCCAACTAAAAATGACGAATGTATATGTAAAGAAAACT
TTTAATTTGAATAAGGTTCAGAAACTAATTGTGAAATAGTATGTCAAAATAATGCTAAAT
AGAAAAATAAAAATGAATGCTCTTGTACAAAACAAGGTTATGAATTTTATCCTGGATCTA
TAGTCAAATGCAGAAAAAGATGTGGGGATAATGCCATATAATTTGATGAAAATAATTGTC
AATGTCCATAAGACTTCTAATTTGTTAATGGTTCTGACTCAGATTGCGAAATAAAATGTG
GAAAAAATGCTAATAGGATAAGCTCAAAATAATGCTAATGTATAGACAAATTTGATTTTA
TAGAAAACTCTATTACAGATTGTAGAATTAAATGTGGTTATAAATCAGTTAATTTAGATG
ATCATAATTGTACCTGCGAAAAAGGATATTATGCCCAACCTGGATCTTTGACTGAGTGTT
AACGTTTTTGTGGACCACACTAAGTGAATTAAGACAGAGAGAACTGTATTTGTGAAAAAG
GATTTGAGGCTGTACCAGGTGTTGCACCACTTGAATGTAGCATAGTTTGTGGACACAAAT
CTGTAAAGGAATCATAATTTAAGTGCAAATGCGAAAATGGATATTAATTAAAAGAAGGTT
CTCTTTCTGAATGCAGCGTTAAATGTGGGTAAAATGCTATTAATGACAAAAATAATAATG
ACATTTGTGTATGTAAGGATGAGAATTATTAATTTATTATAAACTCAAATATTGATTGTG
AGTTTAAACCATATCAAGAAGCATCATTCAGTGCATCTAACTTAAAGTACTATAGTTCTT
TTTATATTATAACTGGCTTGTCATTTTTTTCTTTTGGTTTGCTTTTGGTTGCTTGGAAAT
TAGATGCCAGGGATATGCTCCGAGTTATTCCTTCGAAATCACATTTGCCAACTTTTTTCC
TTGAAACTTCATAAATAAAAGTTTCACATCTAGTAAATTTTAGCAACTAGCCTAGTAATA
TAAGAAACGATGATGAAAAAGCTCAAAATAATTAATATAAAAGAAAATAGCATATTTCAA
CTATCCTTAATGCTACTATAACAATGAATCATGACTAAACAGCTCCACTTGATTTTTCAG
ATTTTGATAAAGCACAAGAAGCAAAAAACGCTACTACTATTTAATAATTAAACATTACTA
TTGATAACTAAGAAGCCACTAAAAATTAACTTGATTTTAGTGATTTCGACAATAATCCTG
AAATGTAGAAAAAAATAAATGATAGTAAAATTTATGTAAGTACTAAATAGAATTCCTCAA
TTTTAATGAATAATTTAAATTCTTCTGTTTTAAACAATACCAGTTAATTATAATTAGACT
AATAAAATGTGTTAGATTTGAACTAATCAGCAATAGCTTAATCTCCTAATTAAAAGCATA
TGAAACTATCATCACCTGATCAACTAAAAACAAAAGCTACTCCTGTTTTAAACACATCAA
CTCCTTTCCCTTATACATAAAAATCTAAAACTGAAAAAGGAACATCATTATTTGCAATTA
TTTGGGTAAATAATCAATTAATTTAAATATAAATTTAATATTAACTTAATTTATTAAAAG
TTTAATCATGAATTTGTTAGTATATGGACTCGCTATGATAAAGATTTATCTAGATCTTTA
AGATCTTTCTTAATCCACTTGAAATAGATATTCTAAATAGGGATAATATCACTCTTACCA
ATTGTAAATTATAATTTCTAACACTCAATTATTAATTAATTTTAATTTTACTATATACAG
TAATAGATTGGAATAGGAATTGTAACAGCATTTGCAAGTTCTATTGTATTCTTGGCTATT
AAAAAACTCATAAAATTATATGGAAGTACTAAAAGTTTAGTGGCAAGAATCTTAAAATAT
AGTATTTTATTATCTTTATCAGGCTTACTTTATTTAGCCAGTATCTAAAAACTCATCGAC
TAAACCTCTCATAAAGACTCTTTTGGTAGCCATATGATATCCTTAGCATTTCTTTTAAGT
ACTGGATTAGATTAAATAGTAATCCAACCTATAATAGCTTTAATTTCTTATAAAATGCAA
ATGAATAAAGTATTTGATCTAAGCCCAACTAAAATATGA