Identifiers and Description

Gene Model Identifier

TTHERM_00016050

Standard Name

CUT1 (Common Unknown Trans-membrane)

Aliases

PreTt11912 | 1.m00960

Description

Cleft lip and palate transmembrane protein 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04193 ) PQ loop repeat
  • ( PF05602 ) Cleft lip and palate transmembrane

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00016050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02639.19.997093137033517e-262cleft lip and palate transmemb
rane protein 1 (607 aa)
OxytrichaContig18924.0.g313.000712232670428e-104Cleft lip and palate transmemb
rane protein 1 (CLPTM1)
DictyBaseDDB_G02831159.996584278131743e-91cnrB on chromosome: 4 position
264436 to 266640
WormBaseWBGene000113022.9986068920536807e-84status:Confirmed UniProt:Q22
003 protein_id:CAA90663.1
Stentor CoeruleusSteCoe_95432.031092662734811e-42

General Information

Paragraph NoGene NameParagraph Text
40CUT1Tetrahymena thermophila gene CUT1 (Common Unknown Trans-membrane) protein is a trans-membrane protein with unknown function. This gene is closely related to a similar gene in Ichthyophthirius multifiliis. It contains two CLPTM1 functional domains, one of which is more strongly conserved than the other. When expressed in the human genome, this domain is known to be linked to cleft lip and palate. This family (CLPTM 1) is one of many eukaryotic, trans membrane protein sequences that are linked to cleft lip and palate; however, specific function is unknown. Kristina Millar and Caroline Hays, undergraduates at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

  1. Ref:SUPR000059

Sequences

>TTHERM_00016050(coding)
ATGAATATTAGCACAAGTAGGCGAAGTTAATAAGATCAACAACAATCTTCTTAAAATTAA
TAGAATTAATAGTAATAAAATGTACCTGCCTAGCAAGAAGAATAGCAGTAGCAATAATAG
GGAGGATGGAACTTCTCAATGTTTCATATGATCTTGCTTTTTATTGCTGGAAATTTTGTT
TTCAATATGATTAAGGGTAATAATATAGATAGAAGCAATCCTAATTACTACCACAATGCG
TTTGAAAATGATTAAAATTTTGATTTAAAGATAAAAATTATCAAAGACAACGAAGTCTTG
CACAGTTGGGAGACTTAGAATTTGCAATACAATTATGATGAAAAAAATTTTATTAACAAA
ACATTTTCTCTCACTTAAGAGTAAATTTTCAGCGAGCCTTATCCAGAAGTGAGTATAAGC
ATAAGAAACTAGGATACTGGAGCTTAATTGAACGCATAAGGCGAATTAGTTGTTATTTAA
GAAAAGATCACTAAAGAGCAGCTATAGAATTTGATTTCATCTGCAAATGAAGACGTTCCT
CAACCTAAAACTAAGAAAGAAAGCAAGAAGAGAGAGAAAGCTCCTCACTTTAGGTAAAGA
TTTTACATATAGCTTTCACATGACACCAATTCGTATCATCCTTAGCAAATACCTCCTTAA
TTGAGAAATCTCCTCAAGATAGATCACTAAAAAAGATTGTACCTTCCTATTTTGGATGTG
TCTTAATTCTGGGTTAGACGTAAAGATTTAGTATATCAAGGTTAAATCGAAGAAGAACTT
GCTGAAGAAAACAAGAATTAACCTGCAACAACAGCAACCTAGGAGGTTATTGATTAAAAT
GATTTGCCATCAGTTTACAACACTACTATTGTCTTCTATCCTTACTGGCATGCAAAGCTT
CTTATGATAAGCCAGATGGAATAAACATTTAATGATTAAGCAAGTTATGGATTACACGAT
GCAAATTCTTTAGAACAATTCAAAGAAATTTTAGGAGACAATAACCCTTATTATTTAGCA
ATTACATTTATTGTTTCAATCCTACATTCTGTTTTTGAATTGCTAGCTGTTAAAAATGAT
ATTTCTTATTGGAGGAATTTAGAAAACTATCAAGGTTTAAGCTTGAGAAGTTTATACACT
GGATTCGTATTTGAGGTTGTTGTATTCCTTTATTTACTTGATAGTGAAGAAACTAGTTGG
CTTATCATAGCCTCTTCGGGCATAGAGTTGTTGGTAACAGTTTGGAAGATCTACAAAACT
GCAAAGTGTTAAAGAAGAAAAGACAACAAATTCCCATTCTTCGAAATTGATTAAACCCAA
CAAAGTTATATTCGCACAACTGAAGAGTATGACAAGCAAGCAACTAAGTATTTGTATTAT
GCTTTGGTTCCCTTATTAGCTGGATACACTGTTTACTCTCTTATCTACCTTGAGCACAAG
GGTTGGTACTCATTCGTAATTAGAACTTTAGTCGGATTCATTTATGTCTTTGGTTTTATT
AATATGACTCCTTAGCTATATATTAACTACAAGCTTAAGAGCGTTGAGCATTTACCATGG
AGAACTATGATTTATAAGTTTTTGAACACTATTGTAGATGACTTGTTCGCCTTTGTCATC
AGTATGCCTTTGCTCAAGAGACTTTCTTGTTTCAGAGATGATATTATTTTCATAATCTAT
ATCTATCAGAGATAAATTTATAAGGTTGACCACAAAAGAACACAACACGGTTTCAAAAAA
GAAGACCTTGTACCTTCAGACCAAAAAGAAAAAGCTGACTGA


>TTHERM_00016050(protein)
MNISTSRRSQQDQQQSSQNQQNQQQQNVPAQQEEQQQQQQGGWNFSMFHMILLFIAGNFV
FNMIKGNNIDRSNPNYYHNAFENDQNFDLKIKIIKDNEVLHSWETQNLQYNYDEKNFINK
TFSLTQEQIFSEPYPEVSISIRNQDTGAQLNAQGELVVIQEKITKEQLQNLISSANEDVP
QPKTKKESKKREKAPHFRQRFYIQLSHDTNSYHPQQIPPQLRNLLKIDHQKRLYLPILDV
SQFWVRRKDLVYQGQIEEELAEENKNQPATTATQEVIDQNDLPSVYNTTIVFYPYWHAKL
LMISQMEQTFNDQASYGLHDANSLEQFKEILGDNNPYYLAITFIVSILHSVFELLAVKND
ISYWRNLENYQGLSLRSLYTGFVFEVVVFLYLLDSEETSWLIIASSGIELLVTVWKIYKT
AKCQRRKDNKFPFFEIDQTQQSYIRTTEEYDKQATKYLYYALVPLLAGYTVYSLIYLEHK
GWYSFVIRTLVGFIYVFGFINMTPQLYINYKLKSVEHLPWRTMIYKFLNTIVDDLFAFVI
SMPLLKRLSCFRDDIIFIIYIYQRQIYKVDHKRTQHGFKKEDLVPSDQKEKAD


>TTHERM_00016050(gene)
ATGAATATTAGCACAAGTAGGCGAAGTTAATAAGATCAACAACAATCTTCTTAAAATTAA
TAGAATTAATAGTAATAAAATGTACCTGCCTAGCAAGAAGAATAGCAGTAGCAATAATAG
GGAGGATGGAACTTCTCAATGTTTCATATGATCTTGCTTTTTATTGCTGGAAATTTTGTT
TTCAATATGATTAAGGGTAATAATATAGATAGAAGCAATCCTAATTACTACCACAATGCG
TTTGAAAATGATTAAAATTTTGTAATATTTTTAATTATTAATCGCCTTATTTAAATCATT
CATTTTAAGTTTAGACCATATTTTTTTTGTTTTTGAAAAATGAATGAAATGAAATAAAAA
ATTCAATCAAATAAATAGCTCATTTAATTTTTTAAATTTTGCAGGATTTAAAGATAAAAA
TTATCAAAGACAACGAAGTCTTGCACAGTTGGGAGACTTAGAATTTGCAATACAATTATG
ATGAAAAAAATTTTATTAACAAAACATTTTCTCTCACTTAAGAGTAAATTTTCAGCGAGC
CTTATCCAGAAGTGAGTATAAGCATAAGAAACTAGGATACTGGAGCTTAATTGAACGCAT
AAGGCGAATTAGTTGTTATTTAAGAAAAGATCACTAAAGAGCAGCTATAGAATTTGATTT
CATCTGCAAATGAAGACGTTCCTCAACCTAAAACTAAGAAAGAAAGCAAGAAGAGTAATA
AATCAATCAATAGATCAATCAATTAATTTAGAAACTATTTTTTATGATTTTTAAAGATTA
TTTTAAAATAACTTAGGAGAGAAAGCTCCTCACTTTAGGTAAAGATTTTACATATAGCTT
TCACATGACACCAATTCGTATCATCCTTAGCAAATACCTCCTTAATTGAGAAGTAAAATT
ATATTTTAATTGCTTTGATAAGTGTTCAACAATATATAATTAAATGCAAAGATCTCCTCA
AGATAGATCACTAAAAAAGATTGTACCTTCCTATTTTGGATGTGTCTTAATTCTGGGTTA
GACGTAAAGATTTAGTATATCAAGGTTAAATCGAAGAAGAACTTGCTGAAGAAAACAAGA
ATTAACCTGCAACAACAGCAACCTAGGAGGTTATTGATTAAAATGATTTGCCATCAGTTT
ACAACACTACTATTGTCTTCTATCCTTACTGGCATGCAAAGCTTCTTATGATAAGCCAGA
TGGAATAAACATTTAATGATTAAGCAAGTTATGGATTACACGATGCAAATTCTTTAGAAC
AATTCAAAGAAATTTTAGGAGACAATAACCCTTATTATTTAGCAATTACATTTATTGTTT
CAATCCTACATTCTGTTTTTGAATTGCTAGCTGTTAAAAATGGTAAAAACATTTACATTG
ACTTCATTCATTCATTGATGTTTTGCTTAAAGGCATTATTTACTTATTTTTATTTATACT
TTGCTTTTTGCTTTTAAGCATTTGGATTAAATAATATTTTTTTTTAGATATTTCTTATTG
GAGGAATTTAGAAAACTATCAAGGTTTAAGCTTGAGAAGTTTATACACTGGATTCGTATT
TGAGGTTGTTGTATTCCTTTATTTACTTGATAGTGAAGAAACTAGTTGGCTTATCATAGC
CTCTTCGGGCATAGAGTTGTTGGTAACAGTTTGGAAGATCTACAAAACTGCAAAGTGTTA
AAGAAGAAAAGACAACAAATTCCCATTCTTCGAAATTGATTAAACCCAACAAAGTTATGT
ATAAAAAAAGTTAAAAATTTTTAGCAAAAATAAATGATAAATTTTAATAAAAAGATTCGC
ACAACTGAAGAGTATGACAAGCAAGCAACTAAGTATTTGTATTATGCTTTGGTTCCCTTA
TTAGCTGGATACACTGTTTACTCTCTTATCTACCTTGAGCACAAGGGTTGGTACTCATTC
GTAATTAGAACTTTAGTCGGATTCATTTATGTCTTTGGTAAATAATTATTAACATAAAAA
ATTTTAATATTTTGTTTAATTTTAATTTAATTAATTTAAAAAATATAAAGGTTTTATTAA
TATGACTCCTTAGCTATATATTAACTACAAGCTTAAGAGCGTTGAGCATTTACCATGGAG
AACTATGATTTATAAGTTTTTGAACACTATTGTAGATGACTTGTTCGCCTTTGTCATCAG
TATGCCTTTGCTCAAGAGACTTTCTTGTTTCAGAGATGGTATTAACTTGTTTATTTATTT
ACTTATTATTTTGTACTAATTCTAATTTTTACTAAATAATATTAGATATTATTTTCATAA
TCTATATCTATCAGAGATAAATTTATAAGGTTGACCACAAAAGAACAGTAATTAAATTTA
TTTATTTTGTTTTTTATTTATATTCATCGCTTTATTTATTTATTTATTTGTTTGTTTCTT
AGCAACACGGTTTCAAAAAAGAAGACCTTGTACCTTCAGACCAAAAAGAAAAAGCTGACT
GA