Identifiers and Description

Gene Model Identifier

TTHERM_01337390

Standard Name

CTR9 (Cln Three (CLN3) Requiring 9)

Aliases

PreTt02557 | 333.m00017 | 3795.m00072

Description

TPR Domain containing protein; member of S.cerevisiae PAF complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01337390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21101.19.997093137033517e-262TPR Domain containing protein
(1148 aa)
OxytrichaContig20366.0.g51.999576471039937e-58TPR repeat
WormBaseWBGene000071844.000437458487249e-40TPR repeat-containing protein
B0464.2 status:Partially_con
firmed UniProt:Q03560 prot
ein_id:CAA79544.1
DictyBaseDDB_G02778416.000354955737408e-39ctr9 on chromosome: 3 position
746082 to 749671
Stentor CoeruleusSteCoe_132251.4251640827409352e-21
SGDYOL145C0.000000000007996637300921877CTR9 Component of the Paf1p co
mplex; binds to and modulates
the activity of RNA polymerase
s I and II; required for expre
ssion of a subset of genes, in
cluding cyclin genes; contains
TPR repeats; possibly involve
d in transcription elongation
as a component of the PAF comp
lex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01337390(coding)
ATGGAAAAAATAATACGCAAATTAGAAACTTAAGGTCATATCGATATCAAAGAATTACCT
TAAGATTTAGTTAAATTCTATGCTGAATGCTCTACAAAGGAAATATCTTTAGATTTATGG
AATAGAATTGCAATTTCACTTTATGAAAATGGAGAATCTGAAAAATTTAATTCAATTATG
CATTATATTCAATCTATTGAAATGGATAAACCTATTCATGACACCCCTTCAGGCAGGGTT
TACAAAAGAAATATCAATAATACTAATATTTAAGCTTTGATAGCTAAAGCCAGCAAAGAA
GAGAGCATTGAATAAAGAAACAATTATTTCCAATAAGCAATTCAAACGCTTAATACATCT
AGGATAAAAGATGTTAAATCTTTGACTCATTCAATTTAAGGATTTATAAATTTCTATCAA
AACAAATAAGTTGGTATAACTTAAAAAAACTTATAAAATGCTTGTGTCTAGGATAAAAAT
GATATTATTGATATTTTAGGTTAAGCATAAATTTTCTTCTTTGCTAAAGATTATTCAAAA
GCTTTAGAATATTTCAAAGAAGCTTTGTAAAAGAATCCTAAATTACCAGGAAGGGCAAGA
CTTGGATTGGCTTATTGTTTCTTTATGCAGAAGAAATTTGAGCTTTCTAAGAGAGCTTTT
TAAAGAGTTATTGATTTGGATAAGACTGTATATGAAGCCTATCTAGGTCTAGCTATCTTA
GCCTTTTAAAGAAAAGAATGGAATGTTTACATTTAAAATTTGAATAAAGCATATGAGCTA
AATAAAAGCAGTCCTCTTGTTTTATATTATATTGCAGAGTTTTACTATATTTAATAAGAT
AATGTTAATACTAAGAAAATGGCATTTTAGGCTATTAACAATTTAAAAAATCTTCCTAAA
ATATTGATGGATTCTGACAAACTTAAAACATATGTTAAATAAACTAGATCAGATTTTTAT
GATATCAAATCCAGGTTGTATCAAATGATTGGTAGCTGCTTCCACAGAGAAAAAAAATAT
GAATTAGCTTAGAAATTCTATGAACAATCACTGTAATCTAATAGAGCTAATATTCAATCT
TGTTTTTGCCTTGCTTAAATATTTATTCAAAATCAACAATACGATTAGGCCTTTAGAAGA
TTAGAAGAAATTCGTAATCAATGTCCAGAAAATGAAAAAGAATTGACTTTTGAGTTTTTT
AAACCTTTAGCTTATCTACAATCAAAGCTTGCACTTGGATAAAATAAATAAACACAACAA
TAATACTACCTAAAAGCACTAAATTATAATCCATAAGATTTTGAAGCCTAGTTAGAGTAT
GCCAATAACTTGACTGATATTGATGCTCATGAATCTTTACGCTACTTTAAATAAGCATTA
TCAGTTTTAAATGAAAAAAAGGAGAGAATCAATCCAGAAATATATAATAATATTGGTGTA
CTTGAATCTCATCTCAAAAACTATCAAAAGGCCATTGAAGCTTTTGAATAAGCAATCAAG
TTAGCTGTTTAATCTAATCAAGAAGGTGGTGTGAATGTTTTCTCTAAAAATTACTAAAAT
AATACAAACGAAATTGAGACAGACTAAGACAAAGAGGAATCAGAAACCAAGAGAAAAAGT
TTTTTATGCACTGTTAAATTTAATATGGCTGCCATGTATGAAGACCTTAAATAAAATGAA
AATGCTTTTAGTTTATATTAAGAAGTTTTGAACATATGTCCTTACTACTTAGATTCCTAT
GTTAGATTAGCTTACCTTGAATTTAAGAAGGGAAGCTTCTAAAATGCTATTAAGTATTGT
GAGGAAGCTCTTGTAAAAAAGGATGAAGCCAAATCTAATAATGTTAGATCTGATCTTGTT
TTATGCATGAAAGGATATATTCATAGTTAATATGATGACGATTAATCTGCTAGAGAAGCA
TTTAATTTAATAAAAAAATAGGGTTTTAATGATAATTACTCTAAGCTATTTGTTTACTAC
ATGGATTATGAACAATAAATTGAAAAGAGAGATAATTAAGAGTCTTAAAAAAAAATAATG
ATTATTGGAGAAAAGATAAAGGAAATATTAGGATTAGATCAAACAAATATTCAAGCCTTA
ATAGTTTTGGCAGTAGTTTTAGCTGAAAATGGGTAAATTAATGAAGCTAAGGAGATTTTC
AATAGTCTAAAAGAGAATATCTCAGTTTTCCCTAATATTTTATTTAACTTAGGTTAGATC
TAATATTTGGAGAAAAATTATGGAGAAGCTCTTATGAATTATAAAAAATTCTAAGAAAAA
TCAAGTTTGGTCAAAGATGAGTACCTTCTTACTTAAATTGCATTGTGCAACTTGCATTTG
GAAAAATATGCTGAGGCAAAAACATAAATCAAGAAACTTATTTTGAGATATCCAAGCTCT
GTAGTTCATCGCTATAATTATTATATGATTTAATTAATTGAGGTGGAAAAGATCTTCTCT
AATGCTGATAGATCTTTGAAGGATAAAGAGAATGCCTTTATAATTTGTAAAAGAGCAAAA
GAATTTTTAGATTTCTTTAAATCTGATTAGAAATGTAAAAAATCTAGATCAGAACACTTC
AGTACTTATGTTAAACAAAAGAGAACAGATTTCTTCAATTCTATTTTAGAACAGCTTGAA
ACTAAAAGAATGATGTTAGAAAGTAACATGCCCTAGTTTGAAAAAATGCTTGATGAGGCT
AGATAAAAGTAATAATAATCCCAAGGATATCATTAAAATGAGGAAGAGGTATTTAGAAAA
TGGAAAATGGAGTAAGAACTAAAAAAATCAAAAATAGAAGAAGAAAAGAGATTGCAAGAA
TTGAAACTTGAATAAAAGTTTGCTGAAAGAATTAGAAAATAGGAAGAGATTTAAAAAATA
TTAGAAGAAAACAAAGTAAAATAAGAAGAAAAGAAACAAAGATCATCTTCTAATAAGGGG
AAATCTAAATCATCTGGAAAAAGATAAAAAAATGAAGAAGATGAATTTATAGATGATGAT
AATGGATTAGATAATTTAAGCGAACTTTTTGACGGTGATGTTGTCGATTATGCAGTCTCA
GGAGATTAGCAAGAATAAGAGGAAATATTTAATGATGATGGTGATGGTGAAGAAGAGATA
TAATTACCATAAAGAAAATTGGATAGTGCTAAAGAACCAAAGACTCTCAAAAAAAGAAAA
TTAAATAAAATGAAGAGTAAAAATAGAGAAGATGAGAATGAATTTGATGATTTCGATGAA
AATTAAGGAGAATAGGAATTTTAACATCAAGATGATAATTAAATGGAGGAAGAGGAATAA
ATAGTAGTAGAAAAATAGAATGAAGTGGTAAATGTACAAAAGAAGCCACCAAAAAGAAAT
CTTGTTTTGGACGATAATGATGACGAAGATGTAGAGAATATGTTCTAAGACTGA


>TTHERM_01337390(protein)
MEKIIRKLETQGHIDIKELPQDLVKFYAECSTKEISLDLWNRIAISLYENGESEKFNSIM
HYIQSIEMDKPIHDTPSGRVYKRNINNTNIQALIAKASKEESIEQRNNYFQQAIQTLNTS
RIKDVKSLTHSIQGFINFYQNKQVGITQKNLQNACVQDKNDIIDILGQAQIFFFAKDYSK
ALEYFKEALQKNPKLPGRARLGLAYCFFMQKKFELSKRAFQRVIDLDKTVYEAYLGLAIL
AFQRKEWNVYIQNLNKAYELNKSSPLVLYYIAEFYYIQQDNVNTKKMAFQAINNLKNLPK
ILMDSDKLKTYVKQTRSDFYDIKSRLYQMIGSCFHREKKYELAQKFYEQSLQSNRANIQS
CFCLAQIFIQNQQYDQAFRRLEEIRNQCPENEKELTFEFFKPLAYLQSKLALGQNKQTQQ
QYYLKALNYNPQDFEAQLEYANNLTDIDAHESLRYFKQALSVLNEKKERINPEIYNNIGV
LESHLKNYQKAIEAFEQAIKLAVQSNQEGGVNVFSKNYQNNTNEIETDQDKEESETKRKS
FLCTVKFNMAAMYEDLKQNENAFSLYQEVLNICPYYLDSYVRLAYLEFKKGSFQNAIKYC
EEALVKKDEAKSNNVRSDLVLCMKGYIHSQYDDDQSAREAFNLIKKQGFNDNYSKLFVYY
MDYEQQIEKRDNQESQKKIMIIGEKIKEILGLDQTNIQALIVLAVVLAENGQINEAKEIF
NSLKENISVFPNILFNLGQIQYLEKNYGEALMNYKKFQEKSSLVKDEYLLTQIALCNLHL
EKYAEAKTQIKKLILRYPSSVVHRYNYYMIQLIEVEKIFSNADRSLKDKENAFIICKRAK
EFLDFFKSDQKCKKSRSEHFSTYVKQKRTDFFNSILEQLETKRMMLESNMPQFEKMLDEA
RQKQQQSQGYHQNEEEVFRKWKMEQELKKSKIEEEKRLQELKLEQKFAERIRKQEEIQKI
LEENKVKQEEKKQRSSSNKGKSKSSGKRQKNEEDEFIDDDNGLDNLSELFDGDVVDYAVS
GDQQEQEEIFNDDGDGEEEIQLPQRKLDSAKEPKTLKKRKLNKMKSKNREDENEFDDFDE
NQGEQEFQHQDDNQMEEEEQIVVEKQNEVVNVQKKPPKRNLVLDDNDDEDVENMFQD


>TTHERM_01337390(gene)
ATGGAAAAAATAATACGCAAATTAGAAACTTAAGGTCATATCGATATCAAAGAATTACCT
TAAGATTTAGTTAAATTCTATGCTGAATGCTCTACAAAGGAAATATCTTTAGATTTATGG
AATAGAATTGCAGTAATTCCTTTTATTAAATTGATTATTTAGATTAATGCCCAATCATAT
TCTCAATTTATTAATCATTATTTTAACAATATTTTTGAATAAATAAATATCCTTATTAAA
TATTTTTACTAATTCAAAAGATTTCACTTTATGAAAATGGAGAATCTGAAAAATTTAATT
CAATTATGCATTATATTCAATCTATTGAAATGGATAAACCTATTCATGACACCCCTTCAG
GCAGGGTTTACAAAAGAAATATCAATAATACTAATATTTAAGCTTTGATAGCTAAAGCCA
GCAAAGAAGAGAGCATTGAATAAAGAAACAATTATTTCCAATAAGCAATTCAAACGCTTA
ATACATCTAGGATAAAAGATGTTAAATCTTTGACTCATTCAATTTAAGGTACTAATTTAG
ATGATTTCATTTTTAAATTTTCTTATGTCTAGAATATGATATTAAAATAATTATTAAAAT
AATAGGATTTATAAATTTCTATCAAAACAAATAAGTTGGTATAACTTAAAAAAACTTATA
AAATGCTTGTGTCTAGGATAAAAATGATATTATTGATATTTTAGGTTAAGTAAATTACTA
AGAATGATTATTGATTTATATTAAAATTTAATATATTATTATTATTTTAGGCATAAATTT
TCTTCTTTGCTAAAGATTATTCAAAAGCTTTAGAATATTTCAAAGAAGCTTTGTAAAAGA
ATCCTAAATTACCAGGAAGGGCAAGACTTGGATTGGCTTATTGTTTCTTTATGCAGAAGA
AATTTGAGCTTTCTAAGAGAGCTTTTTAAAGAGTTATTGATTTGGTAAAAGATAAAAAAC
ATAAAATAACATATATCATATGATTTATTTATAAAAATAGGATAAGACTGTATATGAAGC
CTATCTAGGTCTAGCTATCTTAGCCTTTTAAAGAAAAGAATGGAATGTTTACATTTAAAA
TTTGAATAAAGCATATGAGCTAAATAAAAGCAGTCCTCTTGTTTTATATTATATTGCAGA
GTTTTACTATATTTAATAAGATAATGTTAATGTAAATAGCTAAAAAAAATACACTTATTT
CTAAATTTATTTAATTAAATATTATTCTAGACTAAGAAAATGGCATTTTAGGCTATTAAC
AATTTAAAAAATCTTCCTAAAATATTGATGGATTCTGACAAACTTAAAACATATGTTAAA
TAAACTAGATCAGATTTTTATGATATCAAATCCAGGTTGTATCAAATGATTGGTAGCTGC
TTCCACAGAGAAGTAATTTTTTTAATCTAAAGTATAAATTCTAAACTTATGACAAAATTT
TTAATTTAATTAGAAAAAATATGAATTAGCTTAGAAATTCTATGAACAATCACTGTAATC
TAATAGAGCTAATATTCAATCTTGTTTTTGCCTTGCTTAAATATTTATTCAAAATGTAAT
ATTTTTATTTTAAATTTGCCTCTGTACCAAAATAAATTATTGTTTTATTAAAAGCAACAA
TACGATTAGGCCTTTAGAAGATTAGAAGAAATTCGTAATCAATGTCCAGAAAATGAAAAA
GAATTGACTTTTGAGTTTTTTAAACCTTTAGCTTATCTACAATCAAAGCTTGCACTTGGA
TAAAATAAATAAACACAACAATAATACTACCTAAAAGCACTAAATTATAATCCATAAGAT
TTTGAAGCCTAGTTAGAGTATGCCAATAACTTGACTGATATTGATGCTCATGAATCTTTA
CGCTACTTTAAATAAGCATTATCAGTTTTAAATGAAAAAAAGGAGAGAATCAATCCAGAA
ATATATAATAATATTGGTGTACTTGAATCTCATCTCAAAAACTATCAAAAGGCCATTGAA
GCTTTTGAATAAGCAATCAAGTTAGCTGTTTAATCTAATCAAGAAGGTGGTGTGAATGTT
TTCTCTAAAAATTACTAAAATAATACAAACGAAATTGAGACAGACTAAGACAAAGAGGAA
TCAGAAACCAAGAGAAAAAGTTTTTTATGCACTGTTAAATTTAATATGGCTGCCATGTAT
GAAGACCTTAAATAAAATGAAAATGCTTTTAGTTTATATTAAGAAGTTTTGAACATATGT
CCTTACTACTTAGATTCCTATGTTAGATTAGCTTACCTTGAATTTAAGAAGGGAAGCTTC
TAAAATGCTATTAAGTATTGTGAGGAAGCTCTTGTAAAAAAGGATGAAGCCAAATCTAAT
AATGTTAGATCTGATCTTGTTTTATGCATGAAAGGATATATTCATAGTTAATATGATGAC
GATTAATCTGCTAGAGAAGCATTTAATTTAATAAAAAAATAGGGTTTTAATGATAATTAC
TCTAAGCTATTTGTTTACTACATGGATTATGAACAATAAATTGAAAAGAGAGATAATTAA
GAGTCTTAAAGTATATCTTTAAATATTTATTTACAATAAAAAATAAAAATTAATTAACAT
GGTTTTTCAAATATTAAATAGAAAAAATAATGATTATTGGAGAAAAGATAAAGGAAATAT
TAGGATTAGATCAAACAAATATTCAAGCCTTAATAGTTTTGGCAGTAGTTTTAGCTGAAA
ATGGGTAAATTAATGAAGCTAAGGAGATTTTCAATAGTCTAAAAGAGAATATCTCAGTTT
TCCCTAATATTTTATTTAACTTAGGTTAGATCTAATATTTGGAGAAAAATTATGGAGAAG
CTCTTATGAATTATAAAAAATTCTAAGAAAAATCAAGTTTGGTCAAAGATGAGTACCTTC
TTACTTAAATTGCATTGTGCAACTTGCATTTGGAAAAATATGCTGAGGCAAAAACATAAA
TCAAGAAACTTATTTTGAGATATCCAAGCTCTGTAGTTCATCGCTATAATTATTATATGA
TTTAATTAGTAAATAAATTATTATTTTTCTGATAAAATTTAATTTAAAAATTGTTAATTT
AAATATTATTTTAGATTGAGGTGGAAAAGATCTTCTCTAATGCTGATAGATCTTTGAAGG
ATAAAGAGAATGCCTTTATAATTTGTAAAAGAGCAAAAGAATTTTTAGATTTCTTTAAAT
CTGATTAGAAATGTAAAAAATCTAGATCAGAACACTTCAGTACTTATGTTAAACAAAAGA
GAACAGATTTCTTCAATTCTATTTTAGAACAGCTTGAAACTAAAAGAATGATGTTAGAAA
GTAACATGCCCTAGTTTGAAAAAATGCTTGATGAGGCTAGATAAAAGTAATAATAATCCC
AAGGATATCATTAAAATGAGGAAGAGGTATTTAGAAAATGGAAAGTAATGAATAAATAAA
TAATTTTTAATGAAATTTCATTTTTAATTTATTATAATATATTATACAGATGGAGTAAGA
ACTAAAAAAATCAAAAATAGAAGAAGAAAAGAGATTGCAAGAATTGAAACTTGAATAAAA
GTTTGCTGAAAGAATTAGAAAATAGGAAGAGATTTAAAAAATATTAGAAGAAAACAAAGT
AAAATAAGAAGTAATTTAACTTAAAAATCATTCATCCAATTCAGCTAATTTTTTAAAATT
AATAATTATAGGAAAAGAAACAAAGATCATCTTCTAATAAGTACTAAGAATATTTATATT
ATGATTACTTTCATTTATATAAAATTAATTTAATAGGGGGAAATCTAAATCATCTGGAAA
AAGATAAAAAAATGAAGAAGATGAATTTATAGATGATGATAATGGATTAGATAATTTAAG
CGAACTTTTTGACGGTGATGTTGTCGATTATGCAGTCTCAGGAGATTAGCAAGAATAAGA
GGAAATATTTAATGATGATGGTGATGGTGAAGAAGAGATATAATTACCATAAAGAAAATT
GGATAGTGCTAAAGAACCAAAGACTCTCAAAAAAAGAAAATTAAATAAAATGAAGAGTAA
AAATAGAGAAGATGAGAATGAATTTGATGATTTCGATGAAAATTAAGGAGAATAGGAATT
TTAACATCAAGATGATAATTAAATGGAGGAAGAGGAATAAATAGTAGTAGAAAAATAGAA
TGAAGTGGTAAATGTACAAAAGAAGCCACCAAAAAGAAATCTTGTTTTGGACGATAATGA
TGACGAAGATGTAGAGAATATGTTCTAAGACTGA