Identifiers and Description

Gene Model Identifier

TTHERM_00079650

Standard Name

CTH94 (cathepsin 94)

Aliases

PreTt10210 | 5.m00561 | 3828.m01473

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00079650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06987.19.997093137033517e-262papain family cysteine proteas
e containing protein (344 aa)
OxytrichaContig19092.0.g434.998711177326993e-55Papain family cysteine proteas
e
DictyBaseDDB_G02909571.999385218781115e-51cprA on chromosome: 5 position
4812963 to 4814596
WormBaseWBGene000070551.9998323414791308e-36locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
Stentor CoeruleusSteCoe_251859.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079650(coding)
ATGTCAAAGTTATTAATTGCAGTCCTACTTTGCTTAGCAATCATCACTCCCACTGTCCTT
TGTGATGATTCATAACAAAATATCTCAGTCCAAGACTTATTAGCTTACAATAAGTGGAGA
CAAAAACACCAAAGAGTCTATTTGAATGAAGATGAACAACTCTACAGACAACTTGTTTTC
TTTGAGAACCTTGCTAAAATCAACTCTCATGCTTCCAATACCGAAGCTACTTTCACTGTT
AGTTTGAACTAGTTCTCTGACTACACTCAAGAAGAATTTAAACACAGAATCCTCAATAAG
AAGCTCGGTTAGAGATCTACTCCCAGAGAAGCTGTTGCCGAATAACCCCATTTACTAGGT
GCTTCTATTGCTACATCTATTGATTGGAGAACTAAGCCTAATGTCTTAAACCCTGTTAAG
GACTAAGGACAATGTGGTTCTTGTTGGACATTTGGTGCTGCTGGTGTTATGGAATCATTC
AATGCTATCAAGAATGGTGTTCTTAAAAAATTCTCTGAACAATAGTTGGTTGATTGTGTT
CACTAAGCTGGTTATGTTTCTGATGGTTGCAACGGTGGTTTCTAAGAAGATGGTGTCAAT
TATGCCATTAAGTACGGTATTGTCTAAAGTTCTTCTTATCCATACACAGGTGTTGGTGGA
AGATGCAAGATTACTTCTCCCACTTCTCCTTCAGTTGGATTCTATCCCAAGTCATTCTAA
AAGGTTGCTTAAACCTCAAGTGCTTTGAAGGCAGCTCTTAACTTATATCCAGTAACTGTA
TCTGTTGATGCTTCTAACTGGAGTTCCTACTCTGGTGGTATTTTTAACAACTGTGGTCCT
ACTACTGATCAAGATCTTAACCATGCTGTTATTGCTGTTGGTTATGATGCTTAAGGAAAC
TGGATCATCAGAAACTCATGGAGTGCTTATTGGGGTGAAAATGGTTACATTAGATTAGCT
CCTGGTAACACTTGTGGTGTTCTATTAGATAACTTGTATGTTACTGCTTGA


>TTHERM_00079650(protein)
MSKLLIAVLLCLAIITPTVLCDDSQQNISVQDLLAYNKWRQKHQRVYLNEDEQLYRQLVF
FENLAKINSHASNTEATFTVSLNQFSDYTQEEFKHRILNKKLGQRSTPREAVAEQPHLLG
ASIATSIDWRTKPNVLNPVKDQGQCGSCWTFGAAGVMESFNAIKNGVLKKFSEQQLVDCV
HQAGYVSDGCNGGFQEDGVNYAIKYGIVQSSSYPYTGVGGRCKITSPTSPSVGFYPKSFQ
KVAQTSSALKAALNLYPVTVSVDASNWSSYSGGIFNNCGPTTDQDLNHAVIAVGYDAQGN
WIIRNSWSAYWGENGYIRLAPGNTCGVLLDNLYVTA


>TTHERM_00079650(gene)
AAATAAAAACAAAATAAATAAAAAAAATAAATAAATAAACAAACAATAAACTAAAAAATG
TCAAAGTTATTAATTGCAGTCCTACTTTGCTTAGCAATCATCACTCCCACTGTCCTTTGT
GATGATTCATAACAAAATATCTCAGTCCAAGACTTATTAGCTTACAATAAGTGGAGACAA
AAACACCAAAGAGTCTATTTGAATGAAGATGAACAACTCTACAGACAACTTGTTTTCTTT
GAGAACCTTGCTAAAATCAACTCTCATGCTTCCAATACCGAAGCTACTTTCACTGTTAGT
TTGAACTAGTTCTCTGACTACACTCAAGAAGAATTTAAACACAGAATCCTCAATAAGAAG
CTCGGTTAGAGATCTACTCCCAGAGAAGCTGTTGCCGAATAACCCCATTTACTAGGTGCT
TCTATTGCTACATCTATTGATTGGAGAACTAAGCCTAATGTCTTAAACCCTGTTAAGGAC
TAAGGACAATGTGGTTCTTGTTGGACATTTGGTGCTGCTGGTGTTATGGAATCATTCAAT
GCTATCAAGAATGGTGTTCTTAAAAAATTCTCTGAACAATAGTTGGTTGATTGTGTTCAC
TAAGCTGGTTATGTTTCTGATGGTTGCAACGGTGGTTTCTAAGAAGATGGTGTCAATTAT
GCCATTAAGTACGGTATTGTCTAAAGTTCTTCTTATCCATACACAGGTGTTGGTGGAAGA
TGCAAGATTACTTCTCCCACTTCTCCTTCAGTTGGATTCTATCCCAAGTCATTCTAAAAG
GTTGCTTAAACCTCAAGTGCTTTGAAGGCAGCTCTTAACTTATATCCAGTAACTGTATCT
GTTGATGCTTCTAACTGGAGTTCCTACTCTGGTGGTATTTTTAACAACTGTGGTCCTACT
ACTGATCAAGATCTTAACCATGCTGTTATTGCTGTTGGTTATGATGCTTAAGGAAACTGG
ATCATCAGAAACTCATGGAGTGCTTATTGGGGTGAAAATGGTTACATTAGATTAGCTCCT
GGTAACACTTGTGGTGTTCTATTAGATAACTTGTATGTTACTGCTTGA