Identifiers and Description

Gene Model Identifier

TTHERM_00483410

Standard Name

CTH91 (cathepsin 90)

Aliases

PreTt06275 | 58.m00247 | 3719.m00101

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 46.9%

TetraMine Data

TTHERM_00483410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04244.13.000712232670428e-104papain family cysteine proteas
e containing protein (328 aa)
OxytrichaContig322.1.g1163.000969471571755e-58Papain family cysteine proteas
e
DictyBaseDDB_G02838673.000458792073453e-56cprC on chromosome: 4 position
1092858 to 1094270
WormBaseWBGene000007761.0000844672813518e-48locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_81451.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00483410(coding)
ATGAAAATTGTCTTCGGAACTTGCATATTATTAATATTGACTAGTCTTATTGGACTAGGC
TATCTTAACAACCAATCTACACCTTTAAGCCAACTTATCAAAATAAAACCTTAATTTGAA
CATTTCAAGAGTAGATATAACTTACAATTCGATAATAACTAGGAAGAATAATATAGATTA
ATTATATTCCATGAAAATCTCAAACAAATTGAGCAAGACAATAATGATTCTGACAATGGA
TTTGTTTCTGGTGTTAATAAATTTTCACATTTAACTGAAGAAGAATTCAAAGCTAAATAT
TTGAATCGTCGTTAAAGATCTGCTTAAAACTTTTAAAACTATCCAATTCTTTCTTCATAA
AAAAACACTAATGAAAAACTACCAGAAAGTGTAGATTGGAGAAAATAAGGTGCAGTGTCA
CCTGTTAGAGATCAAGGCAATTGTGGTTGCTGTTATGCCATCACCTCTGCAGGAGCTCTT
GAAGGCTTGCATAAAATCAAGACAGGAAAGCTAGAAATCTTTTCTCCTTAATACATTATT
GATTGTTCTAATGGATAGTTTGATAATGCAGGATGTGATGGAGGTACTTCTGCCGGTGTA
TTTTAATTTGTATAAAAACATGGTATCAATTTAGAATCAAGATATCCTTATTAAGATAAA
TAAAATAAGAAATGTTTGAACAAAGAAACTATCTCATTTATTAATGGTTTCAAAGAAATT
CCTAAAGGAGACTGTAAAGAAATAGAGAGAGTTCTTTCTAAACAACCTGTCTCTATTTCT
ATAGATGCTAGAAAATTAAAAAATTATTAATCAGGTATTCTTAAACAATGCTCTAAAAAA
ATTAATTTAGATCATGAGATTTTAGCTGTAGGCTATACTCCTGACTATTTCATCTTAAAA
AATTCCTGGGGAACTGATTGGGGTATTGATGGATACTTCCATGTTTCTAAAGATAATACT
TGTGGTACTTGCGATGATGCTGCTTATCCTACATTGTGA


>TTHERM_00483410(protein)
MKIVFGTCILLILTSLIGLGYLNNQSTPLSQLIKIKPQFEHFKSRYNLQFDNNQEEQYRL
IIFHENLKQIEQDNNDSDNGFVSGVNKFSHLTEEEFKAKYLNRRQRSAQNFQNYPILSSQ
KNTNEKLPESVDWRKQGAVSPVRDQGNCGCCYAITSAGALEGLHKIKTGKLEIFSPQYII
DCSNGQFDNAGCDGGTSAGVFQFVQKHGINLESRYPYQDKQNKKCLNKETISFINGFKEI
PKGDCKEIERVLSKQPVSISIDARKLKNYQSGILKQCSKKINLDHEILAVGYTPDYFILK
NSWGTDWGIDGYFHVSKDNTCGTCDDAAYPTL


>TTHERM_00483410(gene)
ATGAAAATTGTCTTCGGAACTTGCATATTATTAATATTGACTAGTCTTATTGGACTAGGC
TATCTTAACAACCAATCTACACCTTTAAGCCAACTTATCAAAATAAAACCTTAATTTGAA
CATTTCAAGAGTAGATATAACTTACAATTCGATAATAACTAGGAAGAATAATATAGATTA
ATTATATTCCATGAAAATCTCAAACAAATTGAGCAAGACAATAATGATTCTGACAATGGA
TTTGTTTCTGGTGTTAATAAATTTTCACATTTAACTGAAGAAGAATTCAAAGCTAAATAT
TTGAATCGTCGTTAAAGATCTGCTTAAAACTTTTAAAACTATCCAATTCTTTCTTCATAA
AAAAACACTAATGAAAAACTACCAGAAAGTGTAGATTGGAGAAAATAAGGTGCAGTGTCA
CCTGTTAGAGATCAAGGCAATTGTGGTTGCTGTTATGCCATCACCTCTGCAGGAGCTCTT
GAAGGCTTGCATAAAATCAAGACAGGAAAGCTAGAAATCTTTTCTCCTTAATACATTATT
GATTGTTCTAATGGATAGTTTGATAATGCAGGTATTACAACATTTATAAATTTATATATT
TAATTATTAATTTATTTTCAACTAAATGTTATTAAAGGATGTGATGGAGGTACTTCTGCC
GGTGTATTTTAATTTGTATAAAAACATGGTATCAATTTAGAATCAAGGTAAAAAATGTTT
TAAAAGATATTATTTAAAATAAAATGAAATAAATATTTAAATAAAATAATAAAAAATTAC
TGAAATGGTTGATTTAAATTAGAAAGAAAAATATTTTGGAATTTGAGTTAATCTAAAAAT
AACTTGTTAAAAAAATATTAAAGAAAAAAATCAATTAAAAATAAAGAAAAATTATGAATT
GTTTTAGAAACAAAATATTCATCAAAAAAGCTTGTAAAATAAATACTTTAACTAATTTTT
ATCTTAAAAAATACTTAGATATCCTTATTAAGATAAATAAAATAAGAAATGTTTGAACAA
AGAAACTATCTCATTTATTAATGGTTTCAAAGAAATTCCTAAAGGAGACTGTAAAGAAAT
AGAGAGAGTTCTTTCTAAACAACCTGTCTCTATTTCTATAGATGCTAGAAAATTAAAAAA
TTATTAATCAGGTATTCTTAAACAATGCTCTAAAAAAATTAATTTAGATCATGAGATTTT
AGCTGTAGGCTATACTCCTGACTATTTCATCTTAAAAAATTCCTGGGGAACTGATTGGGG
TATTGATGGATACTTCCATGTTTCTAAAGATAATACTTGTGGTACTTGCGATGATGCTGC
TTATCCTACATTGTGA