Identifiers and Description

Gene Model Identifier

TTHERM_00016590

Standard Name

CTH89 (cathepsin 89)

Aliases

PreTt11965 | 1.m01013

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00016590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02602.19.997093137033517e-262papain family cysteine proteas
e containing protein (389 aa)
WormBaseWBGene000070559.998819815181669e-76locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
DictyBaseDDB_G02909573.0005221502158484e-68cprA on chromosome: 5 position
4812963 to 4814596
OxytrichaContig1254.0.g802.000065869309806e-55Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_26286.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00016590(coding)
ATGAGAATTACTTTTGTATTTTTATTGGCAATGCTAGGTGTTAGCATGGCCATAATAAAC
CAGAATTTCCATTATAATTCTACGAAGTAGTTGAATTTGACTTAAGTTAAATAGCTTTTC
TCTAAATTCAAAGCTGAACACAAGAAATTCTATAACTTTTTAGAAGAACAAAGGCGCTTT
GAAATATTTAGATAGAATTTAGACATAATTTCCGAACTGAACTAAGTCGAAGAAGGCACT
GCTGAATATGGAATCACTTAGTTTTCTGATATGACAACAGAAGAATTTAAATCATAAATT
TTAATTCCTTCTACCTATGCTAGAAACTTCACTGGTTCTAGATACCATGGATTCTAAAAA
ATTTCATAAGATGCTCCCACTTCTTACGATTGGCGTGATCATGGAGCTGTTACTCCTGTT
AAGAATTAGGGTACTGTTGGTACTTGTTGGACTTTCTCAACAACTGGTAACATTGAAGGC
TAATGGTTCTTGGCTGGTAATCCTTTAGTTTCTTTGAGTGAAGAACAAATTGTTGATTGT
GATGGTTCTTAAGAACCTTCTACAGGTCATGCAGATTGTGGTGTTTTTGGTGGATGGCCT
TATCTTGCCTTTGATTATGTTATTAATGCTGGTGGCCTTCCTTCAGAAGAGACTTATCCC
TACTGCGTTGGTAATGGAGGTTGTTACCCATGTCCTGCTCCTGGATACAATGAAACTTTA
TGTGGACCTGCAGTTCCTTATTGCAACGCTACTGCTTACCCTTGCAGACAAGGATAAGTT
CCAATTGCAGCAAAAATTGAAGACTGGAAGGCTTTATCCAAAGATGAAGACTCTATTAAG
CAATAACTCTTTGAAATAGGTCCTCTCTCTGTTGCTCTCGATGCTTCTTATCTATAATTT
TACAAAAAAGGTATTTCTGCACCAAAATTCTGCTCTAAGACTACCCTAAATCACGCAGTT
CTTTTGACTGGTTATGGTATTGATAATGGTGTTGAATTCTGGAATGTCAAGAACAGTTGG
GGAGCTAAATGGGGAGAATAAGGTTATTTCCGTCTAAAAAGAGGTGTTGGAATGTGTGGT
ATTAATACTTAAGTTGCTACTGCAATTGTTAGCAAGTAAGCTTACTCTGAAAAGTTTATG
GAATATGAAGATTATGAACAACCATATTGA


>TTHERM_00016590(protein)
MRITFVFLLAMLGVSMAIINQNFHYNSTKQLNLTQVKQLFSKFKAEHKKFYNFLEEQRRF
EIFRQNLDIISELNQVEEGTAEYGITQFSDMTTEEFKSQILIPSTYARNFTGSRYHGFQK
ISQDAPTSYDWRDHGAVTPVKNQGTVGTCWTFSTTGNIEGQWFLAGNPLVSLSEEQIVDC
DGSQEPSTGHADCGVFGGWPYLAFDYVINAGGLPSEETYPYCVGNGGCYPCPAPGYNETL
CGPAVPYCNATAYPCRQGQVPIAAKIEDWKALSKDEDSIKQQLFEIGPLSVALDASYLQF
YKKGISAPKFCSKTTLNHAVLLTGYGIDNGVEFWNVKNSWGAKWGEQGYFRLKRGVGMCG
INTQVATAIVSKQAYSEKFMEYEDYEQPY


>TTHERM_00016590(gene)
ATGAGAATTACTTTTGTATTTTTATTGGCAATGCTAGGTGTTAGCATGGCCATAATAAAC
CAGAATTTCCATTATAATTCTACGAAGTAGTTGAATTTGACTTAAGTTAAATAGCTTTTC
TCTAAATTCAAAGCTGAACACAAGAAATTCTATAACTTTTTAGAAGAACAAAGGCGCTTT
GAAATATTTAGATAGAATTTAGACATAATTTCCGAACTGAACTAAGTCGAAGAAGGCACT
GCTGAATATGGAATCACTTAGTTTTCTGATATGACAACAGAAGAATTTAAATCATAAATT
TTAATTCCTTCTACCTATGCTAGAAACTTCACTGGTTCTAGATACCATGGATTCTAAAAA
ATTTCATAAGATGCTCCCACTTCTTACGATTGGCGTGATCATGGAGCTGTTACTCCTGTT
AAGAATTAGGGTACTGTTGGTACTTGTTGGACTTTCTCAACAACTGGTAACATTGAAGGC
TAATGGTTCTTGGCTGGTAATCCTTTAGTTTCTTTGAGTGAAGAACAAATTGTTGATTGT
GATGGTTCTTAAGAACCTTCTACAGGTCATGCAGATTGTGGTGTTTTTGGTGGATGGCCT
TATCTTGCCTTTGATTATGTTATTAATGCTGGTGGCCTTCCTTCAGAAGAGACTTATCCC
TACTGCGTTGGTAATGGAGGTTGTTACCCATGTCCTGCTCCTGGATACAATGAAACTTTA
TGTGGACCTGCAGTTCCTTATTGCAACGCTACTGCTTACCCTTGCAGACAAGGATAAGTT
CCAATTGCAGCAAAAATTGAAGACTGGAAGGCTTTATCCAAAGATGAAGACTCTATTAAG
CAATAACTCTTTGAAATAGGTCCTCTCTCTGTTGCTCTCGATGCTTCTTATCTATAATTT
TACAAAAAAGGTATTTCTGCACCAAAATTCTGCTCTAAGACTACCCTAAATCACGCAGTT
CTTTTGACTGGTTATGGTATTGATAATGGTGTTGAATTCTGGAATGTCAAGAACAGTTGG
GGAGCTAAATGGGGAGAATAAGGTTATTTCCGTCTAAAAAGAGGTGTTGGAATGTGTGGT
ATTAATACTTAAGTTGCTACTGCAATTGTTAGCAAGTAAGCTTACTCTGAAAAGTTTATG
GAATATGAAGATTATGAACAACCATATTGA