Identifiers and Description

Gene Model Identifier

TTHERM_00079580

Standard Name

CTH87 (cathepsin 87)

Aliases

PreTt10203 | 5.m00554 | 3828.m01466

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00079580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06987.13.000007771147671e-160papain family cysteine proteas
e containing protein (344 aa)
OxytrichaContig19008.0.g541.0004249259458435e-52Papain family cysteine proteas
e
DictyBaseDDB_G02728151.000499495426459e-47cprE on chromosome: 2 position
2212329 to 2213613
WormBaseWBGene000199864.9998290395614495e-40status:Confirmed UniProt:Q23
030 protein_id:CCD69414.1
Stentor CoeruleusSteCoe_251852.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079580(coding)
ATGTAAAAATTGCTAATTGTCTGCTTATTGGTTTTGGCTGTAGCTATTCCTACTGTCATG
TGCTCTCCTAAGAAGCCCGATGTTTCAGTTAAGGACTTACTTACCTATAACAAATGGAGA
AACACTCATTAAAGAGTCTACTTGAATGAACATGAATAACTTTTCAGATAGTTAATCTTT
TTCGAAAATCTTGCAAAGGTCAACCAACACAATTAAAATGGTAATGCTACTTATACCATT
GGTTTGAACAAATTTTCTGATTTCACTCATGAAGAATTCAAGCATATAATTCTTAATAAG
AAACTCGGAACTAGAGGTTAAAGATTGTTACAAGATACTGATGGGGAAGATAACAGTAAT
ACTAATGATAACAACAACTAAAATAATACTAACTCTACAATTGCTGCTTCTATTGACTGG
AGAAACGTCAATAATGTTTTAAACCCTGTTAAGGACTAAGGTTAATGTGGTTCTTGCTGG
ACTTTTGGTGCTGCTGGTGTCATGGAATCTTTCAATGCTATTACTAATGGAGTACTCAAG
AGCTTCTCTGAATAATAACTTGTTGACTGTGTTCACCAAGCTGGTTTCAATTCTGACGGT
TGCAATGGTGGTTTCTAATCAGATGGTGTTGAATATGCTATCAAGTTTGGTATTGTAACT
GAAGACTAATACCCTTACACTGCAGTTGGTGGTGATTGCTAAATTACTGATCCTACATCT
GATGGTTTCTACCCTAAATCTTACAAAAAACTCCAACAAACTGCTGATGACTTAAAGAGT
GGTTTGAATTTCTCACCTGTTACCGTTTCAGTTGATGCTTCAAACTGGAGTTCTTACGAA
AGTGGTATTTTTGATAACTGTGGAGAAACTACTGAGCAACAACTTAACCATGCTGTCATT
GCTGTTGGTTATGATACAGATGGTAACTGGATTATTAGAAACTCTTGGAGTACTTCTTGG
GGTGAAGATGGCTATATGAGATTAGCTGCTGGTAACACTTGTGGTGTTTTACTTGATACA
TTAATTGTCACTGCTTGA


>TTHERM_00079580(protein)
MQKLLIVCLLVLAVAIPTVMCSPKKPDVSVKDLLTYNKWRNTHQRVYLNEHEQLFRQLIF
FENLAKVNQHNQNGNATYTIGLNKFSDFTHEEFKHIILNKKLGTRGQRLLQDTDGEDNSN
TNDNNNQNNTNSTIAASIDWRNVNNVLNPVKDQGQCGSCWTFGAAGVMESFNAITNGVLK
SFSEQQLVDCVHQAGFNSDGCNGGFQSDGVEYAIKFGIVTEDQYPYTAVGGDCQITDPTS
DGFYPKSYKKLQQTADDLKSGLNFSPVTVSVDASNWSSYESGIFDNCGETTEQQLNHAVI
AVGYDTDGNWIIRNSWSTSWGEDGYMRLAAGNTCGVLLDTLIVTA


>TTHERM_00079580(gene)
TTTTAAATAATTATTAAAAAATAAAAATAAAACTAAAAAAATATTCAATAAATGTAAAAA
TTGCTAATTGTCTGCTTATTGGTTTTGGCTGTAGCTATTCCTACTGTCATGTGCTCTCCT
AAGAAGCCCGATGTTTCAGTTAAGGACTTACTTACCTATAACAAATGGAGAAACACTCAT
TAAAGAGTCTACTTGAATGAACATGAATAACTTTTCAGATAGTTAATCTTTTTCGAAAAT
CTTGCAAAGGTCAACCAACACAATTAAAATGGTAATGCTACTTATACCATTGGTTTGAAC
AAATTTTCTGATTTCACTCATGAAGAATTCAAGCATATAATTCTTAATAAGAAACTCGGA
ACTAGAGGTTAAAGATTGTTACAAGATACTGATGGGGAAGATAACAGTAATACTAATGAT
AACAACAACTAAAATAATACTAACTCTACAATTGCTGCTTCTATTGACTGGAGAAACGTC
AATAATGTTTTAAACCCTGTTAAGGACTAAGGTTAATGTGGTTCTTGCTGGACTTTTGGT
GCTGCTGGTGTCATGGAATCTTTCAATGCTATTACTAATGGAGTACTCAAGAGCTTCTCT
GAATAATAACTTGTTGACTGTGTTCACCAAGCTGGTTTCAATTCTGACGGTTGCAATGGT
GGTTTCTAATCAGATGGTGTTGAATATGCTATCAAGTTTGGTATTGTAACTGAAGACTAA
TACCCTTACACTGCAGTTGGTGGTGATTGCTAAATTACTGATCCTACATCTGATGGTTTC
TACCCTAAATCTTACAAAAAACTCCAACAAACTGCTGATGACTTAAAGAGTGGTTTGAAT
TTCTCACCTGTTACCGTTTCAGTTGATGCTTCAAACTGGAGTTCTTACGAAAGTGGTATT
TTTGATAACTGTGGAGAAACTACTGAGCAACAACTTAACCATGCTGTCATTGCTGTTGGT
TATGATACAGATGGTAACTGGATTATTAGAAACTCTTGGAGTACTTCTTGGGGTGAAGAT
GGCTATATGAGATTAGCTGCTGGTAACACTTGTGGTGTTTTACTTGATACATTAATTGTC
ACTGCTTGA