Identifiers and Description

Gene Model Identifier

TTHERM_00735230

Standard Name

CTH84 (cathepsin 84)

Aliases

PreTt25447 | 120.m00105

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF00806 ) Pumilio-family RNA binding repeat
  • ( PF02520 ) Domain of unknown function DUF148
  • ( PF03544 ) Gram-negative bacterial tonB protein
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00735230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18921.19.999130229490956e-141papain family cysteine proteas
e containing protein (328 aa)
DictyBaseDDB_G02909574.998233068678632e-48cprA on chromosome: 5 position
4812963 to 4814596
OxytrichaContig322.1.g1162.99915080840225e-45Papain family cysteine proteas
e
WormBaseWBGene000007763.00039543526891e-44locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_270843.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00735230(coding)
ATGAATAAATCAATATTGATTTTTGCATTTTTAGCAGCTGCACTTTTTGGGTCAGCATTG
TATATGGCGGTTAAAAAATAACATATTACAATAGATGAATCAGTAACTAAGATTTGGAGT
TAATGGAAATAAAAACACAATAAGAGATATGAAAATACTGATTATGAATCTTACAGGTTG
GAAGTTTTTGCTGAAAATTTAGAAGTAGTTAAAAATGATTAAACTGGAACTTATGGTATA
ACCAAATTTTTAGATCTAACAGACGATGAATTCGCAGGAAATTTTCTCAATTTAAAAGCA
CAATATCCTGAAGATTCTATAGCAGAAGACATTGAAGTAGACCCAAAAATTAACATTAAT
TGGGTTGAAGCAGGAAAAGTTTCTAATGTTAAATCTTAAGGAAACTGCGGTTCCTGCTGG
GCATTTTCAGCAACTGCTTCTGTTGAATCAGCTTTGATTATTGCTGGTAAAGTTGATAAA
TCTATTAGCCTTTCAGAATAGTAATTAATAGATTGTTCTGGAGATTATGGAAATTATGGA
TGCGCTGCTGGATAAAAAGAATAAGCTTTGGTTTATATTAAAAGATATTCAATTACTACT
GAATAAAATTATCCTTATACAGAAAAAGATGTTTAAAAATGTTACTTTGATAACACAAAA
CATATTCCTAATTACACTATTTCTGATATCAAAATTGTTAAAGCATCAACTAATGACTTG
GTAGAAGCTCTCAAGATCTAGCCTGTCGCCGTTTCAGTAGATGCAACTAATTGGAAATAC
TACAAAGGCGGTGTATTTTCTGACTGTAAAACTTATTATCATAACCATGCAGTACTTTTA
GTTGGATTCTAAAATGGAACTTGGCTAGTTAAAAACTCATATGGAACTAATTGGGGAGAA
AATGGCTATATTAGACTTAAAAATGGCAATACATGTGGAGTAGCAAATTAACCTTATCAG
CCTATAATTTGA


>TTHERM_00735230(protein)
MNKSILIFAFLAAALFGSALYMAVKKQHITIDESVTKIWSQWKQKHNKRYENTDYESYRL
EVFAENLEVVKNDQTGTYGITKFLDLTDDEFAGNFLNLKAQYPEDSIAEDIEVDPKININ
WVEAGKVSNVKSQGNCGSCWAFSATASVESALIIAGKVDKSISLSEQQLIDCSGDYGNYG
CAAGQKEQALVYIKRYSITTEQNYPYTEKDVQKCYFDNTKHIPNYTISDIKIVKASTNDL
VEALKIQPVAVSVDATNWKYYKGGVFSDCKTYYHNHAVLLVGFQNGTWLVKNSYGTNWGE
NGYIRLKNGNTCGVANQPYQPII


>TTHERM_00735230(gene)
ATGAATAAATCAATATTGATTTTTGCATTTTTAGCAGCTGCACTTTTTGGGTCAGCATTG
TATATGGCGGTTAAAAAATAACATATTACAATAGATGAATCAGTAACTAAGATTTGGAGT
TAATGGAAATAAAAACACAATAAGAGATATGAAAATACTGATTATGAATCTTACAGGTTG
GAAGTTTTTGCTGAAAATTTAGAAGTAGTTAAAAATGATTAAACTGGAACTTATGGTATA
ACCAAATTTTTAGATCTAACAGACGATGAATTCGCAGGAAATTTTCTCAATTTAAAAGCA
CAATATCCTGAAGATTCTATAGCAGAAGACATTGAAGTAGACCCAAAAATTAACATTAAT
TGGGTTGAAGCAGGAAAAGTTTCTAATGTTAAATCTTAAGGAAACTGCGGTTCCTGCTGG
GCATTTTCAGCAACTGCTTCTGTTGAATCAGCTTTGATTATTGCTGGTAAAGTTGATAAA
TCTATTAGCCTTTCAGAATAGTAATTAATAGATTGTTCTGGAGATTATGGAAATTATGGA
TGCGCTGCTGGATAAAAAGAATAAGCTTTGGTTTATATTAAAAGATATTCAATTACTACT
GAATAAAATTATCCTTATACAGAAAAAGATGTTTAAAAATGTTACTTTGATAACACAAAA
CATATTCCTAATTACACTATTTCTGATATCAAAATTGTTAAAGCATCAACTAATGACTTG
GTAGAAGCTCTCAAGATCTAGCCTGTCGCCGTTTCAGTAGATGCAACTAATTGGAAATAC
TACAAAGGCGGTGTATTTTCTGACTGTAAAACTTATTATCATAACCATGCAGTACTTTTA
GTTGGATTCTAAAATGGAACTTGGCTAGTTAAAAACTCATATGGAACTAATTGGGGAGAA
AATGGCTATATTAGACTTAAAAATGGCAATACATGTGGAGTAGCAAATTAACCTTATCAG
CCTATAATTTGA