Identifiers and Description

Gene Model Identifier

TTHERM_00877100

Standard Name

CTH80 (CaTHepsin 80)

Aliases

PreTt09706 | 156.m00090

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.6%

TetraMine Data

TTHERM_00877100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03181.12.0004882463825047e-175papain family cysteine proteas
e containing protein (377 aa)
WormBaseWBGene000007764.9995619603214884e-57locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
OxytrichaContig19092.0.g439.995951036711152e-55Papain family cysteine proteas
e
DictyBaseDDB_G02797998.998068369452149e-53cprB on chromosome: 3 position
2569081 to 2570624
Stentor CoeruleusSteCoe_26284.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00877100(coding)
ATGCTCACTTTTAGCTTTTATATTAAAAGTTAAAGTAACTTGATATCTCCAACATAAACT
GCTGTTCAAGATAATTAAAATAGTTAACCATAAAATGATATTAATGAAACAATTATGAAA
GAATTTTAAAAGTTTAAGAAAACTTTTAGAAAAAGATACGCTGATTCTGAGGGAGATTAT
AGATTCTAAATATTTGCAGAAAATTATAACTATATTCATAATTATAACCAAATTAATGAA
AACTCCCAAGATAATATATAGCTTGAAGTTAATGAGTTTGCTGATTTGAGTTTGTAAGAA
TTTAGAGAGCTCTATTTTGGGTATAACTCTTCTAAGAAACACAACAATCAGCAAAACGGT
TCTACTAAAAATTTAAGATAAAGTTTTCTACTAAGTGACTCTGTTCCAGAATCTGTAGAT
TGGAGAGAAAAGCTTGTTGCCCCTGTTTAAAAATAAGGTGGATGTGGAAGTTGTTGGGCA
TTTTCAACAGTTATAGCTTTGGAAGGTGCTTATGCTAAGCAAACAGGTAATGTTATAAAA
TTTAGTGAACAAAATTTAATCGACTGCTGTAGAATTGAAAACAATGGATGTAACGGAGGT
GATCCAGAACCTGCCTTAGATTGTGTAATGAATGTCTTAAAAGGAATTATGAAAAATTAA
GATTATCCCTATTAAGCTATTACTAGAAAGGAATGTGATCACGATTAATCAAAAAATGTC
TTCAGTCCAGATGGATACGAAAATATACCTATAAACAACGAATTAGCAATCAAAGAAGCT
GTTTCAAGATAACCGATATCTGCTTGTATTTCAGGTTCCTCATAAAATTTCAAATTCTAC
AAAGGCGGTATAGCTGATGAAAAATTACTTGAATGTGATCCTTAATATACAGATCATTGC
CTAGGAATAGTTGGATATGGTTCTGAAAACGGGAAGCAGTATTGGATACTTAAAAATTCA
TGGGGAGAAAACTGGGGAGAAAAGGGATATATCAGATTATTAAGATCTGATAGCTCAAAT
ACTCAAGGAACATGTGGTATAGCTACTGAGCCAAGAATAGTAAATTAGCAAACAAAAAAA
TAGCTTGCACAAATATGA


>TTHERM_00877100(protein)
MLTFSFYIKSQSNLISPTQTAVQDNQNSQPQNDINETIMKEFQKFKKTFRKRYADSEGDY
RFQIFAENYNYIHNYNQINENSQDNIQLEVNEFADLSLQEFRELYFGYNSSKKHNNQQNG
STKNLRQSFLLSDSVPESVDWREKLVAPVQKQGGCGSCWAFSTVIALEGAYAKQTGNVIK
FSEQNLIDCCRIENNGCNGGDPEPALDCVMNVLKGIMKNQDYPYQAITRKECDHDQSKNV
FSPDGYENIPINNELAIKEAVSRQPISACISGSSQNFKFYKGGIADEKLLECDPQYTDHC
LGIVGYGSENGKQYWILKNSWGENWGEKGYIRLLRSDSSNTQGTCGIATEPRIVNQQTKK
QLAQI


>TTHERM_00877100(gene)
ATGCTCACTTTTAGCTTTTATATTAAAAGTTAAAGTAACTTGATATCTCCAACATAAACT
GCTGTTCAAGATAATTAAAATAGTTAACCATAAAATGATATTAATGAAACAATTATGAAA
GAATTTTAAAAGTTTAAGAAAACTTTTAGAAAAAGATACGCTGATTCTGAGGGAGATTAT
AGATTCTAAATATTTGCAGAAAATTATAACTATATTCATAATTATAACCAAATTAATGAA
AACTCCCAAGATAATATATAGCTTGAAGTTAATGAGTTTGCTGATTTGAGTTTGTAAGAA
TTTAGAGAGCTCTATTTTGGGTATAACTCTTCTAAGAAACACAACAATCAGCAAAACGGT
TCTACTAAAAATTTAAGATAAAGTTTTCTACTAAGTGACTCTGTTCCAGAATCTGTAGAT
TGGAGAGAAAAGCTTGTTGCCCCTGTTTAAAAATAAGGTATAATGTTTTAGTGTTTTTTT
ATCAATAATAAATACTATTTCTCTTTTAATTTAATTTTATGACTTGCGATATTAAATTCT
AATTATAGAATCTATTATTGTTAAAGAAATAATCTAGTCTTGGATATTATTATTTATATA
TAAACATTAATTTTAACAATAAAAAATAATGTATCAAATATTCAATCATATAAAAAAATA
TAAACAAAATATGTAAATTGCTTACATTTCTAAATACATCAATAAATCATTTTAAAATTA
TGAATTTTTTAAATAAAAATAAAATAAATAGGTGGATGTGGAAGTTGTTGGGCATTTTCA
ACAGTTATAGCTTTGGAAGGTGCTTATGCTAAGCAAACAGGTATTTTTCTTTCATCAGAG
AATATTTTAATTTTTTTTTAAAAAAATTGATTAAAATTATGAGTTAAATTTAAAAAAATA
CTTACTTACTTTTTAATCAGATAACTCAATATTACGATATTGATTAAGATTATTTTTTTT
TCCTAGATTTTCCCTTTTTTAACTTAAAAATATTTGGTGAATAATCAGGAATCACAAAAA
TTTAATGATATAAAAAACAATATTATTTTTTACCAATAAGAAACTATGTCACACTTTTTT
ATATCTTGACTAAATTTCTTTACATTATTAAGAAATTAATTTTTTAATTTAAATTATTTT
ATTTTATTTAATTTGCAAAAAATAAATAAATTATTTTATAATTAGGTAATGTTATAAAAT
TTAGTGAACAAAATTTAATCGACTGCTGTAGAATTGAAAACAATGGATGTAACGGAGGTG
ATCCAGAACCTGCCTTAGATTGTGTAATGAATGTCTTAAAAGGAATTATGAAAAATTAAG
ATTATCCCTATTAAGCTATTACTAGAAAGGAATGTGATCACGATTAATCAAAAAATGTCT
TCAGTCCAGATGGATACGAAAATATACCTATAAACAACGAATTAGCAATCAAAGAAGCTG
TTTCAAGATAACCGATATCTGCTTGTATTTCAGGTTCCTCATAAAATTTCAAATTCTACA
AAGGCGGTATAGCTGATGAAAAATTACTTGAATGTGATCCTTAATATACAGATCATTGCC
TAGGAATAGTTGGATATGGTTCTGAAAACGGGAAGCAGTATTGGATACTTAAAAATTCAT
GGGGAGAAAACTGGGGAGAAAAGGTAAGAAAAATATATTTTAAATATTTATTTTAGAATA
TTAAACTGCTATTTTTTATAAAAAAAAGGGATATATCAGATTATTAAGATCTGATAGCTC
AAATACTCAAGGAACATGTGGTATAGCTACTGAGCCAAGAATAGTAAATTAGCAAACAAA
AAAATAGCTTGCACAAATATGA