Identifiers and Description

Gene Model Identifier

TTHERM_00558010

Standard Name

CTH79 (cathepsin 79)

Aliases

PreTt07899 | 73.m00143 | 3735.m00037

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 70.8%

TetraMine Data

TTHERM_00558010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14365.19.997093137033517e-262papain family cysteine proteas
e containing protein (378 aa)
OxytrichaContig19008.0.g544.0018838296491823e-56Papain family cysteine proteas
e
WormBaseWBGene000007761.0004249259458435e-52locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
DictyBaseDDB_G02816056.002971818577897e-50cfaD on chromosome: 3 position
4701100 to 4702904
Stentor CoeruleusSteCoe_270844.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558010(coding)
ATGAATAAATTAATAATATTGGCAATTGTTTTAGGCTTAACAGTTTCTTAAACCTATAAC
AGTAATTTGAAATAATACACATTCGATTAATATATCCAAGACTTCAACAAGGGATATTAA
TATGGATCTTCAGAATACTTCATGAGAAAAGCTATATTTGAATAGAAATTAGCTGAAATC
ATTGCTTTCAACGAATAAACTAATTAATCATACAAAAAGGGTGTTAACAGATTTACTGAC
TTAACAGACAGCGAATTCAAGTAAAATAGCTTAGGATACAGCAAAAACATGAGTAATGTT
AGAGCTTTCCGTAACTTATCTGTTAAGAATTTGGAAGTTACTGAATAATAATTAAAGGAA
TTACCCGTTAATGTTGATTGGAGATAAAAAGGAGTTGTTACCCCAGTTAAAGATTAAGGT
CACTGCGGTTCTTGTTGGGCTTTTGCTTCAACTGCTACTATTGAATCCTATGCAGCCATT
AACTCTGGTTAATTGAAAACTTTATCTACTCAATAACTCGTAAGTTGTGTTCCTAACCCT
TACTAATGTGGTGGTACTGGTGGTTGCAATGGTGCTATTTCCGAATTAGCATTTAACTAT
GTCTAATTATACGGTTTAACCTCTGAATTCAAATATCCTTATCAAAGTTATGTATCTGGT
GTTACTGGTAACTGTACATTCGATTCAACTTAATAAACCCCTGAAGTAGCTTTAGATGGT
TATGTCAAATTATAGGCTAACGACTACGATGCTTTACTTTATGCTCTTGCCAATATTGGT
CCTTTGGCTGTTGCTGTAGATGCTAGTCAATGGCGTAATTACCAATCTGGTGTCTTCAAC
GGATGCAGTTACACAGACAACATTGATGTAAACCACGTTGTAGTCCTTGTTGGTTACGGT
ACTGATCCTGAATTAGGTGACTATTGGTTGATTAGAAACTCATGGGGTACCAAATTCGGT
GAAAATGGTTATATCAGATTAGCTAGAGAATCTAAGGTTACTTGTGGTACTGACTATACT
CCTTTAGATGGATAAGCTTGTGCTGGCCAAAATGTCCCTACTAAGGTTTGTGGTTAATGT
GGTGTTGCTTATGATGCCGCTTATCCTACAAATGTTAGAGTAATTGGTTGA


>TTHERM_00558010(protein)
MNKLIILAIVLGLTVSQTYNSNLKQYTFDQYIQDFNKGYQYGSSEYFMRKAIFEQKLAEI
IAFNEQTNQSYKKGVNRFTDLTDSEFKQNSLGYSKNMSNVRAFRNLSVKNLEVTEQQLKE
LPVNVDWRQKGVVTPVKDQGHCGSCWAFASTATIESYAAINSGQLKTLSTQQLVSCVPNP
YQCGGTGGCNGAISELAFNYVQLYGLTSEFKYPYQSYVSGVTGNCTFDSTQQTPEVALDG
YVKLQANDYDALLYALANIGPLAVAVDASQWRNYQSGVFNGCSYTDNIDVNHVVVLVGYG
TDPELGDYWLIRNSWGTKFGENGYIRLARESKVTCGTDYTPLDGQACAGQNVPTKVCGQC
GVAYDAAYPTNVRVIG


>TTHERM_00558010(gene)
ATGAATAAATTAATAATATTGGCAATTGTTTTAGGCTTAACAGTTTCTTAAACCTATAAC
AGTAATTTGAAATAATACACATTCGATTAATATATCCAAGACTTCAACAAGGGATATTAA
TATGGATCTTCAGAATACTTCATGAGAAAAGCTATATTTGAATAGAAATTAGCTGAAATC
ATTGCTTTCAACGAATAAACTAATTAATCATACAAAAAGGGTGTTAACAGATTTACTGAC
TTAACAGACAGCGAATTCAAGTAAAATAGCTTAGGATACAGCAAAAACATGAGTAATGTT
AGAGCTTTCCGTAACTTATCTGTTAAGAATTTGGAAGTTACTGAATAATAATTAAAGGAA
TTACCCGTTAATGTTGATTGGAGATAAAAAGGAGTTGTTACCCCAGTTAAAGGTATTATT
TTATTTACAATTATATAATTCATTTAAAGTTAAATCATATTTTTTTAAACTAATAGATTA
AGGTCACTGCGGTTCTTGTTGGGCTTTTGCTTCAACTGCTACTATTGAATCCTATGCAGC
CATTAACTCTGGTTAATTGAAAACTTTATCTACTCAATAACTCGTAAGTTGTGTTCCTAA
CCCTTACTAATGTGGTGGTACTGGTGGTTGCAATGGTGCTATTTCCGAATTAGCATTTAA
CTATGTCTAATTATACGGTTTAACCTCTGAATTCAAATATCCTTATCAAAGTTATGTATC
TGGTGTTACTGGTAACTGTACATTCGATTCAACTTAATAAACCCCTGAAGTAGCTTTAGA
TGGTTATGTCAAATTATAGGCTAACGACTACGATGCTTTACTTTATGCTCTTGCCAATAT
TGGTCCTTTGGCTGTTGCTGTAGATGCTAGTCAATGGCGTAATTACCAATCTGGTGTCTT
CAACGGATGCAGTTACACAGACAACATTGATGTAAACCACGTTGTAGTCCTTGTTGGTTA
CGGTACTGATCCTGAATTAGGTGACTATTGGTTGATTAGAAACTCATGGGGTACCAAATT
CGGTGAAAATGGTTATATCAGATTAGCTAGAGAATCTAAGGTTACTTGTGGTACTGACTA
TACTCCTTTAGATGGATAAGCTTGTGCTGGCCAAAATGTCCCTACTAAGGTTTGTGGTTA
ATGTGGTGTTGCTTATGATGCCGCTTATCCTACAAATGTTAGAGTAATTGGTTGA