Identifiers and Description

Gene Model Identifier

TTHERM_00945300

Standard Name

CTH69 (cathepsin 69)

Aliases

PreTt30109 | 173.m00055

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00945300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07843.15.997225115851065e-74hypothetical protein (340 aa)
DictyBaseDDB_G02911917.998505003885351e-50DDB_G0291191 on chromosome: 5
position 5086072 to 5087429
OxytrichaContig19008.0.g541.000499495426459e-47Papain family cysteine proteas
e
WormBaseWBGene000199869.997441244797434e-45status:Confirmed UniProt:Q23
030 protein_id:CCD69414.1
Stentor CoeruleusSteCoe_270841.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00945300(coding)
ATGGATAAATATAAATCAATACTTTTTATCTTTCTCTTTTTGGCTTTTGTACTTGGGCAA
GATAAACAGGAAAGCTTATCTGATTTTGGCAAAAAACATTAATAATAATAATCTTTCTTA
GATTTTAAAAAAAATTTTGCTAAAAAATACCATTCCTAAGAGCATGAGTAGTATAGATTC
AATGTTTTTCTTGAAAATTTAAAAGAAATTGAAAGACTAAATAAAGAAATCACTTCCGCA
AAATTTGCAGTTACTTAATTTTCTGATTACACTAAGGAAGAATTTATGAAACTTTTTACT
GGTGCTGTAATTCCTAATGAAGCTGAATTGTCAAGCAACTCATAAAGCAACTCTGACTCA
GAAGAAAGAAAACTATAATCTCTACCTTCTACATGGGATATTAGAGCTAACGGACCTGGA
ATATTACAAGCCGTAAAAAATCAAGGCTAATGTGGTAGCTGCTGGACTTTTTCAACCACT
GCTACTGTTGAAAATCTCTATAACATAAAATATGGTTATAATTTATCATTTTCAGAGTAG
TAATAAGTAGATTGTGTATATTAAAGAGATGGCTGCTAAGGAGGTTGGTTCTCAACTGCC
TATTAATTTGTTATGAGTATTGGACTAGCTCTTGAGAATATGTATCCATATACTGGAGTA
TATGGTAGCTGTGCAACTTCATCGATGGGAGGCTATTTATACAGAATAAGCGGCTTTAAC
AATCTACAAGATAACATTACTTAAATTTAGTCATCTATTGTTAATAAAGGAGCTGTGGCT
GTATGTGTTGATGCTTCTTACTGGGGTTAATACTCATCTGGAATTTATTCTGACACAAGA
GCATCAACTACTTCCTGCAATCATGCTGTTACAATAATTGGATATGGACCAGGTTACTGG
TTAATACGTAATAGTTGGGGAGCTAATTGGGGAGAGAATGGTCATATTAGAGTTGCTAAT
AATGGAACTGGAGGAATAAGAACAAATTATGCCTTTTAACCTTACTGA


>TTHERM_00945300(protein)
MDKYKSILFIFLFLAFVLGQDKQESLSDFGKKHQQQQSFLDFKKNFAKKYHSQEHEQYRF
NVFLENLKEIERLNKEITSAKFAVTQFSDYTKEEFMKLFTGAVIPNEAELSSNSQSNSDS
EERKLQSLPSTWDIRANGPGILQAVKNQGQCGSCWTFSTTATVENLYNIKYGYNLSFSEQ
QQVDCVYQRDGCQGGWFSTAYQFVMSIGLALENMYPYTGVYGSCATSSMGGYLYRISGFN
NLQDNITQIQSSIVNKGAVAVCVDASYWGQYSSGIYSDTRASTTSCNHAVTIIGYGPGYW
LIRNSWGANWGENGHIRVANNGTGGIRTNYAFQPY


>TTHERM_00945300(gene)
ATGGATAAATATAAATCAATACTTTTTATCTTTCTCTTTTTGGCTTTTGTACTTGGGCAA
GATAAACAGGAAAGCTTATCTGATTTTGGCAAAAAACATTAATAATAATAATCTTTCTTA
GATTTTAAAAAAAATTTTGCTAAAAAATACCATTCCTAAGAGCATGAGTAGTATAGATTC
AATGTTTTTCTTGAAAATTTAAAAGAAATTGAAAGACTAAATAAAGAAATCACTTCCGCA
AAATTTGCAGTTACTTAATTTTCTGATTACACTAAGGAAGAATTTATGAAACTTTTTACT
GGTGCTGTAATTCCTAATGAAGCTGAATTGTCAAGCAACTCATAAAGCAACTCTGACTCA
GAAGAAAGAAAACTATAATCTCTACCTTCTACATGGGATATTAGAGCTAACGGACCTGGA
ATATTACAAGCCGTAAAAAATCAAGGCTAATGTGGTAGCTGCTGGACTTTTTCAACCACT
GCTACTGTTGAAAATCTCTATAACATAAAATATGGTTATAATTTATCATTTTCAGAGTAG
TAATAAGTAGATTGTGTATATTAAAGAGATGGCTGCTAAGGAGGTTGGTTCTCAACTGCC
TATTAATTTGTTATGAGTATTGGACTAGCTCTTGAGAATATGTATCCATATACTGGAGTA
TATGGTAGCTGTGCAACTTCATCGATGGGAGGCTATTTATACAGAATAAGCGGCTTTAAC
AATCTACAAGATAACATTACTTAAATTTAGTCATCTATTGTTAATAAAGGAGCTGTGGCT
GTATGTGTTGATGCTTCTTACTGGGGTTAATACTCATCTGGAATTTATTCTGACACAAGA
GCATCAACTACTTCCTGCAATCATGCTGTTACAATAATTGGATATGGACCAGGTTACTGG
TTAATACGTAATAGTTGGGGAGCTAATTGGGGAGAGAATGGTCATATTAGAGTTGCTAAT
AATGGAACTGGAGGAATAAGAACAAATTATGCCTTTTAACCTTACTGA