Identifiers and Description

Gene Model Identifier

TTHERM_00691630

Standard Name

CTH68 (cathepsin 68)

Aliases

PreTt03001 | 106.m00141 | 3674.m00054

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17578.14.998065322133077e-171papain family cysteine proteas
e containing protein (335 aa)
OxytrichaContig19008.0.g549.995951036711152e-55Papain family cysteine proteas
e
DictyBaseDDB_G02722981.9990449803848145e-49DDB_G0272298 on chromosome: 2
position 1664020 to 1665049
WormBaseWBGene000007769.995739965151785e-43locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_39402.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691630(coding)
ATGAGAATTATTGCTTTAATAACTCTTTTATTGGTTGTTTCACCTATAATTGCTGATAGT
ACTAACAACTTCTCTGTCAGTGCTCTTTTTGCCTACAATAAGTGGAGATATGCTAATAAA
CGTACCTATTTCTCCCTTGAAGAATAACAATTCAGATAACAAATCTTTTTCGAAACTCAC
GAAAGAATCTAAAACCATAACAGTAACCCAGAAGCCACTTACAAGCTTGCCCATAACTAG
TTCTCTGACATGCCCCAAGAAGAATTTGCTAGTAGAGTACTTATGAAAAGCTCATAATTA
ATCCCTAGAAACGCTGTCTAAGCCTAAAATAATAACTCTACAACTTAATAGCATACTGCT
TAAGATGTCTAATTACCTGCTTCTTTCGATTGGAGAGATTATGGTATTTTATCTGATGTT
AAGGATTAAGGTTAGTGTGGTTCATGCTGGGCTTTCTCTACCACTGGTATCCTCGAAGCT
CTTTACTTTATGGAAAATCGTTAAAAAATTAGCTTCTCTGAACAACAATTAGTTGATTGT
GCTACTAATTCTAATGGTTTTAATTCATACGGTTGTTCTGGTGGCTGGCCTGAAGAAGCC
TTGAAGTATGTTGCTAAGTTTGGTATTCTCAAAGAAGAATAGTATCCTTATTTAGCTGTT
GATTCTAAGTGCAAAGTTTCTTCACCTACTTCTGATGGTTTTAAGGTTTAATCTTTCTAT
TTTATTGACAAGACTGCAGATGCTTTAAAAAACACTGTTGCCAGAATTCCTGTTTCAGTT
TTAGTCGATGCTTCCACTTGGGGTTCTTATTCTTCTGGTGTTTATAATGGATGTGGAAAT
ACATAAACTTACAACTTAAACCATGCTGTAGTTGCTATTGGTTATGATGAATAAGGAAAT
TGGATTATCAGAAACTCTTGGAGTACTTCCTGGGGTATGGACGGACACATGAAGCTTGCT
CCTGGTAATACTTGCGGTATTCTCTTAAGCCCTCTTATTGCAGTTCGTTGA


>TTHERM_00691630(protein)
MRIIALITLLLVVSPIIADSTNNFSVSALFAYNKWRYANKRTYFSLEEQQFRQQIFFETH
ERIQNHNSNPEATYKLAHNQFSDMPQEEFASRVLMKSSQLIPRNAVQAQNNNSTTQQHTA
QDVQLPASFDWRDYGILSDVKDQGQCGSCWAFSTTGILEALYFMENRQKISFSEQQLVDC
ATNSNGFNSYGCSGGWPEEALKYVAKFGILKEEQYPYLAVDSKCKVSSPTSDGFKVQSFY
FIDKTADALKNTVARIPVSVLVDASTWGSYSSGVYNGCGNTQTYNLNHAVVAIGYDEQGN
WIIRNSWSTSWGMDGHMKLAPGNTCGILLSPLIAVR


>TTHERM_00691630(gene)
ATGAGAATTATTGCTTTAATAACTCTTTTATTGGTTGTTTCACCTATAATTGCTGATAGT
ACTAACAACTTCTCTGTCAGTGCTCTTTTTGCCTACAATAAGTGGAGATATGCTAATAAA
CGTACCTATTTCTCCCTTGAAGAATAACAATTCAGATAACAAATCTTTTTCGAAACTCAC
GAAAGAATCTAAAACCATAACAGTAACCCAGAAGCCACTTACAAGCTTGCCCATAACTAG
TTCTCTGACATGCCCCAAGAAGAATTTGCTAGTAGAGTACTTATGAAAAGCTCATAATTA
ATCCCTAGAAACGCTGTCTAAGCCTAAAATAATAACTCTACAACTTAATAGCATACTGCT
TAAGATGTCTAATTACCTGCTTCTTTCGATTGGAGAGATTATGGTATTTTATCTGATGTT
AAGGATTAAGGTTAGTGTGGTTCATGCTGGGCTTTCTCTACCACTGGTATCCTCGAAGCT
CTTTACTTTATGGAAAATCGTTAAAAAATTAGCTTCTCTGAACAACAATTAGTTGATTGT
GCTACTAATTCTAATGGTTTTAATTCATACGGTTGTTCTGGTGGCTGGCCTGAAGAAGCC
TTGAAGTATGTTGCTAAGTTTGGTATTCTCAAAGAAGAATAGTATCCTTATTTAGCTGTT
GATTCTAAGTGCAAAGTTTCTTCACCTACTTCTGATGGTTTTAAGGTTTAATCTTTCTAT
TTTATTGACAAGACTGCAGATGCTTTAAAAAACACTGTTGCCAGAATTCCTGTTTCAGTT
TTAGTCGATGCTTCCACTTGGGGTTCTTATTCTTCTGGTGTTTATAATGGATGTGGAAAT
ACATAAACTTACAACTTAAACCATGCTGTAGTTGCTATTGGTTATGATGAATAAGGAAAT
TGGATTATCAGAAACTCTTGGAGTACTTCCTGGGGTATGGACGGACACATGAAGCTTGCT
CCTGGTAATACTTGCGGTATTCTCTTAAGCCCTCTTATTGCAGTTCGTTGA