Identifiers and Description

Gene Model Identifier

TTHERM_00502370

Standard Name

CTH66 (cathepsin 66)

Aliases

PreTt08076 | 63.m00254 | 3716.m00106

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00502370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07132.12.0004882463825047e-175papain family cysteine proteas
e containing protein (377 aa)
WormBaseWBGene000007763.998479955315009e-46locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
OxytrichaContig16089.0.g21.999683289470905e-41Papain family cysteine proteas
e
DictyBaseDDB_G02816058.003017249547689e-39cfaD on chromosome: 3 position
4701100 to 4702904
Stentor CoeruleusSteCoe_251851.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00502370(coding)
ATGATGAGATTTATGATTCTTGTAGCTCTACTTTGCCTTGTCAATTGCAAGCCAAAGTGG
ACACAACTTTAAAATTACACTTTTGAAAAATATATCAGAGATTTTTAAAAGGAATATAAA
GCAGATTCTGAAGAATACTTAACTAGGAAGAAAATATTTGAATAGAATTTAGCTGATATA
ATTGCCTTCAATAAAGAAGATCATTCCTACAAAAAAGGTGTTAAAAATAATACTGATGAA
AGCTACTTTGAAAAAAAAGAATAGTTTTCCATATTTAAAAGTTAAGTCGACTTTGAAATA
TTGGATCCTTCAACTAGAAAATTTAACTAAACTTATAAAGCTAAAGGCTTGAAAAATTTA
CCATAGAGTGTAGACTGGAGAGAAATAGGTGTTGTATCTCCTGTAAAAGATTAAGGTGAT
TGCTTGTCTTGCTGGGCATTTACTGCAGTTTCCGTTTTGGAGAGTCATGCTGCAATAGCT
GCTGGTTCAGGAAATTTAAAAACTCTGTCAACCTAACAATTAGTTTCTTGTGTCCCTAAC
CCTAAATAATGTGGTGGATAAGGTGGATGTTTTGGTGCTGTTGCTGATTTGGCTTTTGAA
TATACTTCTCAATATGGTATTACTTCTGAATTTAAATATGGCTATAAATCTTATTTTAAT
GACACATATGAATGCAAATTCGATCCCCTCAAATAATAGCCTGAAGTTATAAACTAAGGT
TTTGCTAAAGTAACTCCTAATGATTAATAAGCTCTATTAGAAGCTGTAGCTACAATTGGC
CCTATAGCTATCTCAATTGACTCTACTGGTTGGGATTCCTATGAAGAGGGTGTATTTGAT
GGATGTGATTATTCAGAAAATATTAATATTGACCACGCTGTTGTGTTAGTTGGTTATGGA
ACTGATCCAAAGTACGGAGATTACTGGCTTGTAAGAAATTCTTATGGTACTGAATTTGGC
GAAGATGGTTACATTAGAATAAAAAGAGAAGCTGTACCTTAATGCGGTATAGATAGTACT
CCTACCAATGGTTTTGCTTGTGGAGGTGATGAAACGCCAATTAAAGTTTGTGGTATGTGC
GGAATTCTTTCTGACAGCTCTTATCCTCTCAACGTAAAAGTAATAGTTTGA


>TTHERM_00502370(protein)
MMRFMILVALLCLVNCKPKWTQLQNYTFEKYIRDFQKEYKADSEEYLTRKKIFEQNLADI
IAFNKEDHSYKKGVKNNTDESYFEKKEQFSIFKSQVDFEILDPSTRKFNQTYKAKGLKNL
PQSVDWREIGVVSPVKDQGDCLSCWAFTAVSVLESHAAIAAGSGNLKTLSTQQLVSCVPN
PKQCGGQGGCFGAVADLAFEYTSQYGITSEFKYGYKSYFNDTYECKFDPLKQQPEVINQG
FAKVTPNDQQALLEAVATIGPIAISIDSTGWDSYEEGVFDGCDYSENINIDHAVVLVGYG
TDPKYGDYWLVRNSYGTEFGEDGYIRIKREAVPQCGIDSTPTNGFACGGDETPIKVCGMC
GILSDSSYPLNVKVIV


>TTHERM_00502370(gene)
ATGATGAGATTTATGATTCTTGTAGCTCTACTTTGCCTTGTCAATTGCAAGCCAAAGTGG
ACACAACTTTAAAATTACACTTTTGAAAAATATATCAGAGATTTTTAAAAGGAATATAAA
GCAGATTCTGAAGAATACTTAACTAGGAAGAAAATATTTGAATAGAATTTAGCTGATATA
ATTGCCTTCAATAAAGAAGATCATTCCTACAAAAAAGGTGTTAAAAATAATACTGATGAA
AGCTACTTTGAAAAAAAAGAATAGTTTTCCATATTTAAAAGTTAAGTCGACTTTGAAATA
TTGGATCCTTCAACTAGAAAATTTAACTAAACTTATAAAGCTAAAGGCTTGAAAAATTTA
CCATAGAGTGTAGACTGGAGAGAAATAGGTGTTGTATCTCCTGTAAAAGATTAAGGTGAT
TGCTTGTCTTGCTGGGCATTTACTGCAGTTTCCGTTTTGGAGAGTCATGCTGCAATAGCT
GCTGGTTCAGGAAATTTAAAAACTCTGTCAACCTAACAATTAGTTTCTTGTGTCCCTAAC
CCTAAATAATGTGGTGGATAAGGTGGATGTTTTGGTGCTGTTGCTGATTTGGCTTTTGAA
TATACTTCTCAATATGGTATTACTTCTGAATTTAAATATGGCTATAAATCTTATTTTAAT
GACACATATGAATGCAAATTCGATCCCCTCAAATAATAGCCTGAAGTTATAAACTAAGGT
TTTGCTAAAGTAACTCCTAATGATTAATAAGCTCTATTAGAAGCTGTAGCTACAATTGGC
CCTATAGCTATCTCAATTGACTCTACTGGTTGGGATTCCTATGAAGAGGGTGTATTTGAT
GGATGTGATTATTCAGAAAATATTAATATTGACCACGCTGTTGTGTTAGTTGGTTATGGA
ACTGATCCAAAGTACGGAGATTACTGGCTTGTAAGAAATTCTTATGGTACTGAATTTGGC
GAAGATGGTTACATTAGAATAAAAAGAGAAGCTGTACCTTAATGCGGTATAGATAGTACT
CCTACCAATGGTTTTGCTTGTGGAGGTGATGAAACGCCAATTAAAGTTTGTGGTATGTGC
GGAATTCTTTCTGACAGCTCTTATCCTCTCAACGTAAAAGTAATAGTTTGA