Identifiers and Description

Gene Model Identifier

TTHERM_00128990

Standard Name

CTH61 (CaTHepsin 61)

Aliases

PreTt09463 | 9.m00484 | 3699.m00192

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 90.9%

TetraMine Data

TTHERM_00128990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09211.11.0004771100126706e-129papain family cysteine proteas
e containing protein (324 aa)
DictyBaseDDB_G02728152.998990600740728e-62cprE on chromosome: 2 position
2212329 to 2213613
OxytrichaContig20878.0.0.g705.997545490783615e-57Papain family cysteine proteas
e
WormBaseWBGene000070551.999385218781115e-51locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
Stentor CoeruleusSteCoe_308722.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00128990(coding)
ATGAATTCTAAAATAATTTTCACTGCTTTGCTAGCTTTGTTGTTGAGCTCTTCTTTGGCA
TAACAAAATAACCCATAGATTGAGGCTCTAAATTAATATATTGAATGGATAAAAACTAAC
CCTAAAGTTTTCATTAATGATGATGAAAAGTTATTCAGATAAACTGTCTTCTTAGAAAAC
TTTTAAAAGGTTTAAGATCATAACTCAAACACTTCTCATACTTACAAATTAGGACTTAAT
TAGTTCTCTGATATGACTTAAGAAGAATTTGCTTAAAAGATTCTCACTAACCACTCCATC
AAGAGTTCATCTTAGAAGCTATCAGTATCTTCTTCAAGCACATCTAGCACTTCAATTGCA
GCTTCTTTCGACTGGAGAACTAAGGGAGCACTTACACCTGTAAAAAATCAAGGAAATTGT
GGATCTTGCTGGGCTTTCTCTGCTACTGGTGTTATGGAATCTTTTAACTTCATTAAAAAT
CATGTTCTTACTAGCTTTTCTGAATAGCAGCTTGTTGACTGTGTTACTACAAACAATGGC
TACGTCTCTTATGGCTGCAATGGTGGTTCATACTAGCAAGCATTGCAATATGCTTCAAAA
GTAGGTATGAAAACAGAATCAGCATACCCTTATATTGGATACTAAGGTAGCTGCAAAGTG
AGTGGAACTAGTAATGGATACAAACCAGTTTCTTTCTCGTTTATTAGTTCAACTACCTTG
GCATTATAAACTGCAATAAATGCTTCACCTGTATCAGTTGCAATTGATGCTACTAATTTG
TCTATGTACTCTTCAGGTATTTATAATAATTGCAATCCCTCAAATATCCAATTAAATCAC
GCAGTATTAGCTGTAGGCTATGACACCTAAGGAAACTGGATAGTAAAGAACTCCTGGGGT
ACTTAGTGGGGATAATCAGGTTACTTCTTGCTAGCTCCTAACAACACTTGTGGTATATTA
GATGATCCACTTCATATAACTGCTTGA


>TTHERM_00128990(protein)
MNSKIIFTALLALLLSSSLAQQNNPQIEALNQYIEWIKTNPKVFINDDEKLFRQTVFLEN
FQKVQDHNSNTSHTYKLGLNQFSDMTQEEFAQKILTNHSIKSSSQKLSVSSSSTSSTSIA
ASFDWRTKGALTPVKNQGNCGSCWAFSATGVMESFNFIKNHVLTSFSEQQLVDCVTTNNG
YVSYGCNGGSYQQALQYASKVGMKTESAYPYIGYQGSCKVSGTSNGYKPVSFSFISSTTL
ALQTAINASPVSVAIDATNLSMYSSGIYNNCNPSNIQLNHAVLAVGYDTQGNWIVKNSWG
TQWGQSGYFLLAPNNTCGILDDPLHITA


>TTHERM_00128990(gene)
ATGAATTCTAAAATAATTTTCACTGCTTTGCTAGCTTTGTTGTTGAGCTCTTCTTTGGCA
TAACAAAATAACCCATAGATTGAGGCTCTAAATTAATATATTGAATGGATAAAAACTAAC
CCTAAAGTTTTCATTAATGATGATGAAAAGTTATTCAGATAAACTGTCTTCTTAGAAAAC
TTTTAAAAGGTTTAAGATCATAACTCAAACACTTCTCATACTTACAAATTAGGACTTAAT
TAGTTCTCTGATATGACTTAAGAAGAATTTGCTTAAAAGATTCTCACTAACCACTCCATC
AAGAGTTCATCTTAGAAGCTATCAGTATCTTCTTCAAGCACATCTAGCACTTCAATTGCA
GCTTCTTTCGACTGGAGAACTAAGGGAGCACTTACACCTGTAAAAAATCAAGGAAATTGT
GGATCTTGCTGGGCTTTCTCTGCTACTGGTGTTATGGAATCTTTTAACTTCATTAAAAAT
CATGTTCTTACTAGCTTTTCTGAATAGCAGCTTGTTGACTGTGTTACTACAAACAATGGC
TACGTCTCTTATGGCTGCAATGGTGGTTCATACTAGCAAGCATTGCAATATGCTTCAAAA
GTAGGTATGAAAACAGAATCAGCATACCCTTATATTGGATACTAAGGTAGCTGCAAAGTG
AGTGGAACTAGTAATGGATACAAACCAGTTTCTTTCTCGTTTATTAGTTCAACTACCTTG
GCATTATAAACTGCAATAAATGCTTCACCTGTATCAGTTGCAATTGATGCTACTAATTTG
TCTATGTACTCTTCAGGTATTTATAATAATTGCAATCCCTCAAATATCCAATTAAATCAC
GCAGTATTAGCTGTAGGCTATGACACCTAAGGAAACTGGATAGTAAAGAACTCCTGGGGT
ACTTAGTGGGGATAATCAGGTTACTTCTTGCTAGCTCCTAACAACACTTGTGGTATATTA
GATGATCCACTTCATATAACTGCTTGA