Identifiers and Description

Gene Model Identifier

TTHERM_00842600

Standard Name

CTH59 (CaTHepsin 59)

Aliases

PreTt16245 | 147.m00097 | 3741.m00042

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 52.7%

TetraMine Data

TTHERM_00842600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18921.15.999259200222691e-172papain family cysteine proteas
e containing protein (328 aa)
DictyBaseDDB_G02728151.0000844672813518e-48cprE on chromosome: 2 position
2212329 to 2213613
WormBaseWBGene000007766.001950283815408e-48locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
OxytrichaContig22708.0.g462.000704504372864e-47Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_50441.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00842600(coding)
ATGAACAAATAATTATTGTTATTGGCTCTATTGGGTGCCGCTTTGGTTGGTTCAACTGTA
TTCCTTCTAAATAAATCTAATAAGGATATCAGTGAGTAAGAAACTGTTGCTCAGTTGTGG
TCTCTTTGGAAGAAAACCTACCATAAAAGATACGCAGATCCTGACTCAGAATAATACAGA
ATTTAAGTATTTTCTTCAAACTTAGATTTCATCAAGCAAGATACTACTGGAACTATGGGT
ATCACTAAATTCTTTGATTTGACCGATGAAGAATTCTAAGCTATTTATCTTACTGAATAA
GATACTTTACAAGAACCTGTTGCAGAAGATATTCCAATTGATCCTTCAACAAACATTAAC
TGGGTTACAGAAAACAAAGTCACTGCTGTTAAATAATAAGGAGGTTGTGGTTCTTGCTGG
ACTTTCTCTGCTACTGGTGCATTAGAATCAGCTTTGATTATTGCTGGTAAAGCAGAATAA
ACTATTGATCTTTCTGAATAATAGCTTATTGACTGTTGTGGTGCTTCATATGGTAATTTA
GGTTGTCGCGGTGGTAACAAAGACCAAGCTTTCAGATATGTTGAATCAAATCCTATAACA
ACCGAAAAAAATTATCCTTACTAAGGTTAAAACGGTACTTGTAATTAAACAAAGGCTGCA
TAAACTCCTAATTATTCTATTTCTAGCTATAAGTAAGTAGATGCTTCCACTAAAGCTCTT
GCTGAAGCACTCAAAGTTTAACCAATAGCTATCTCTGTCGACGCTACTTACTTTAAATAC
TACACAAGCGGTATTTACTCTAAATGCAATAATAATACTCATAATCACGCTGTCCTTCTT
GTTGGTTTCTAAGACGATGCTTGGATTGTTAAAAATTCATGGGGTCCTGAATTTGGAGAA
AATGGTTATATTAGACTTAAAAATGGTAACACTTGCGGTGTTGCTAATATTCCATATTAC
CCAATTGTATGA


>TTHERM_00842600(protein)
MNKQLLLLALLGAALVGSTVFLLNKSNKDISEQETVAQLWSLWKKTYHKRYADPDSEQYR
IQVFSSNLDFIKQDTTGTMGITKFFDLTDEEFQAIYLTEQDTLQEPVAEDIPIDPSTNIN
WVTENKVTAVKQQGGCGSCWTFSATGALESALIIAGKAEQTIDLSEQQLIDCCGASYGNL
GCRGGNKDQAFRYVESNPITTEKNYPYQGQNGTCNQTKAAQTPNYSISSYKQVDASTKAL
AEALKVQPIAISVDATYFKYYTSGIYSKCNNNTHNHAVLLVGFQDDAWIVKNSWGPEFGE
NGYIRLKNGNTCGVANIPYYPIV


>TTHERM_00842600(gene)
ATGAACAAATAATTATTGTTATTGGCTCTATTGGGTGCCGCTTTGGTTGGTTCAACTGTA
TTCCTTCTAAATAAATCTAATAAGGATATCAGTGAGTAAGAAACTGTTGCTCAGTTGTGG
TCTCTTTGGAAGAAAACCTACCATAAAAGATACGCAGATCCTGACTCAGAATAATACAGA
ATTTAAGTATTTTCTTCAAACTTAGATTTCATCAAGCAAGATACTACTGGAACTATGGGT
ATCACTAAATTCTTTGATTTGACCGATGAAGAATTCTAAGCTATTTATCTTACTGAATAA
GATACTTTACAAGAACCTGTTGCAGAAGATATTCCAATTGATCCTTCAACAAACATTAAC
TGGGTTACAGAAAACAAAGTCACTGCTGTTAAATAATAAGGAGGTTGTGGTTCTTGCTGG
ACTTTCTCTGCTACTGGTGCATTAGAATCAGCTTTGATTATTGCTGGTAAAGCAGAATAA
ACTATTGATCTTTCTGAATAATAGCTTATTGACTGTTGTGGTGCTTCATATGGTAATTTA
GGTTGTCGCGGTGGTAACAAAGACCAAGCTTTCAGATATGTTGAATCAAATCCTATAACA
ACCGAAAAAAATTATCCTTACTAAGGTTAAAACGGTACTTGTAATTAAACAAAGGCTGCA
TAAACTCCTAATTATTCTATTTCTAGCTATAAGTAAGTAGATGCTTCCACTAAAGCTCTT
GCTGAAGCACTCAAAGTTTAACCAATAGCTATCTCTGTCGACGCTACTTACTTTAAATAC
TACACAAGCGGTATTTACTCTAAATGCAATAATAATACTCATAATCACGCTGTCCTTCTT
GTTGGTTTCTAAGACGATGCTTGGATTGTTAAAAATTCATGGGGTCCTGAATTTGGAGAA
AATGGTTATATTAGACTTAAAAATGGTAACACTTGCGGTGTTGCTAATATTCCATATTAC
CCAATTGTATGA