Identifiers and Description

Gene Model Identifier

TTHERM_00925870

Standard Name

CTH56 (cathepsin 56)

Aliases

PreTt04394 | 165.m00112 | 3747.m00362

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00925870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07844.12.9997246065828143e-59hypothetical protein (343 aa)
OxytrichaContig1254.0.g806.997125142158947e-47Papain family cysteine proteas
e
DictyBaseDDB_G02911915.999907735769095e-44DDB_G0291191 on chromosome: 5
position 5086072 to 5087429
WormBaseWBGene000070559.99648502569394e-38locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
Stentor CoeruleusSteCoe_26282.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925870(coding)
ATGTGGAATAAATAAAAAAGTGTAGTTATTATTTTTATTTTGATATTGCTTGTTACAGGG
CAATAGAATGATAACTAAAATAACTTTAATAAAAAACATTAACACCACAAAAAGTTTAAA
GTCTTCAAAAACACTTATTCTAAGGTTTATGAAAGCAAAGAAGTTGAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAAAGAAATTGATAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTTCACCAAAGAAGAGTTCTTGAATTTGTTCACT
GGAGCACATAAACCTGCTATGTCTGACTAAGATTAATTATAAAACAATAATAACTCAAAT
AATTAAAATGATTAATCAAATAATTAAAAATCATCAGACAAATCAAACTAAAATGAATAA
AAATAAATAGAAGAATCTATTCCTAGTTCTTGGGATATAAGAACAGATGGTCCTGGATTA
TTATAACCAGTCGAAAATCAAGGCCAATGTGGAAGTTGTTGGGCATTTTCTACTTCTGGT
GCAGTAGAGAGCTATTATTCAGCTAAAAAAAATATTACATTGAATCTCTCAAAATAGCAG
TTAGTAGATTGTGTTTATGATCATGGTGGATGTGATGGCGGGTGGTTTAATGATGCTTTT
AAATATATACAAAGCGTTGGTATTGTTTTAAATGCTACTTATTATCCTTACATAAATAAA
GATTAAACTGAACCGTGCTAATTATCTAAATTACCTAAGGGAACATCTTTTTATCAAATA
TAAGGTTATAAAAAATTAGAAAATGATACATCTGTAATAAAATAAGCTATAATGCAGAAC
GGTGCTCTTTCGATAGCAGTTGATGCTACTTATTGGGCAAACTATAAATCTGGTATTTTT
ACTTAAAAAGAAAAACCTTAAATAAATCATGCTGTTACTCTTATAGGATGGGGAAGCGAT
TACTGGCTGCTTAGAAATAGCTGGGGTTCTTCATGGGGTGAATAAGGTTACATCAAAGTT
ACTAACACTGGCTATAGTGGAATATTTCCTTAATATACATATTCACCAATTAAATGA


>TTHERM_00925870(protein)
MWNKQKSVVIIFILILLVTGQQNDNQNNFNKKHQHHKKFKVFKNTYSKVYESKEVEQFRF
ATFVENLKEIDRLNAEVTTAQFDISFFSDFTKEEFLNLFTGAHKPAMSDQDQLQNNNNSN
NQNDQSNNQKSSDKSNQNEQKQIEESIPSSWDIRTDGPGLLQPVENQGQCGSCWAFSTSG
AVESYYSAKKNITLNLSKQQLVDCVYDHGGCDGGWFNDAFKYIQSVGIVLNATYYPYINK
DQTEPCQLSKLPKGTSFYQIQGYKKLENDTSVIKQAIMQNGALSIAVDATYWANYKSGIF
TQKEKPQINHAVTLIGWGSDYWLLRNSWGSSWGEQGYIKVTNTGYSGIFPQYTYSPIK


>TTHERM_00925870(gene)
ATGTGGAATAAATAAAAAAGTGTAGTTATTATTTTTATTTTGATATTGCTTGTTACAGGG
CAATAGAATGATAACTAAAATAACTTTAATAAAAAACATTAACACCACAAAAAGTTTAAA
GTCTTCAAAAACACTTATTCTAAGGTTTATGAAAGCAAAGAAGTTGAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAAAGAAATTGATAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTTCACCAAAGAAGAGTTCTTGAATTTGTTCACT
GGAGCACATAAACCTGCTATGTCTGACTAAGATTAATTATAAAACAATAATAACTCAAAT
AATTAAAATGATTAATCAAATAATTAAAAATCATCAGACAAATCAAACTAAAATGAATAA
AAATAAATAGAAGAATCTATTCCTAGTTCTTGGGATATAAGAACAGATGGTCCTGGATTA
TTATAACCAGTCGAAAATCAAGGCCAATGTGGAAGTTGTTGGGCATTTTCTACTTCTGGT
GCAGTAGAGAGCTATTATTCAGCTAAAAAAAATATTACATTGAATCTCTCAAAATAGCAG
TTAGTAGATTGTGTTTATGATCATGGTGGATGTGATGGCGGGTGGTTTAATGATGCTTTT
AAATATATACAAAGCGTTGGTATTGTTTTAAATGCTACTTATTATCCTTACATAAATAAA
GATTAAACTGAACCGTGCTAATTATCTAAATTACCTAAGGGAACATCTTTTTATCAAATA
TAAGGTTATAAAAAATTAGAAAATGATACATCTGTAATAAAATAAGCTATAATGCAGAAC
GGTGCTCTTTCGATAGCAGTTGATGCTACTTATTGGGCAAACTATAAATCTGGTATTTTT
ACTTAAAAAGAAAAACCTTAAATAAATCATGCTGTTACTCTTATAGGATGGGGAAGCGAT
TACTGGCTGCTTAGAAATAGCTGGGGTTCTTCATGGGGTGAATAAGGTTACATCAAAGTT
ACTAACACTGGCTATAGTGGAATATTTCCTTAATATACATATTCACCAATTAAATGA