Identifiers and Description

Gene Model Identifier

TTHERM_00191270

Standard Name

CTH54 (CaTHepsin 54)

Aliases

PreTt08778 | 15.m00489 | 3697.m00200

Description

Cysteine proteinase 3 precursor, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 85%

TetraMine Data

TTHERM_00191270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06182.19.997093137033517e-262papain family cysteine proteas
e containing protein (345 aa)
OxytrichaContig13288.0.g376.002330506118426e-84Papain family cysteine proteas
e
WormBaseWBGene000007763.999543040313994e-55locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
DictyBaseDDB_G02797991.0000099287337047e-53cprB on chromosome: 3 position
2569081 to 2570624
Stentor CoeruleusSteCoe_294801.2479464629129513e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00191270(coding)
ATGAAACAATCAATCATAATTGTTGCTTTGGCTCTTTTGGCAATTGGTGTTATTGCTAGA
AACCATACCTTTGAAAGAGAAGTTTCTCATGGCAGACACAACGCCACTGAGTAAGAACTT
TTGAATATCTTTTCCTCTTATGGATATGTTGCTAATCCTTCCAGTGAGAGATTTAAAATC
TTTAAACAAAGATTAATTGATATCATCAAGCATAACCTCAATCCTCATAAGACTTACACT
TAAAAAATCAACAAATTCTCATTCTACACTCAGGAAGAGTTATCTGTGTTAAACGCTGCT
TAGAATTGCTCAGCCACTGCCAAAGAAAACATGGCCCCTAAAAAGAAATACAATCTTAAG
GACATTCCTGAATTTGTTGATTGGAGAACTAAGGGTATTGTTACTCCTGTTAAGAATCAA
GGCTAATGTGGTTCTTGTTGGACTTTCTCTACTACTGGTGCTCTTGAATCCCACTGGGCT
TTACACACCGGTAATGCTCCTTTATTACTCTCTGAATAATAATTGATTGACTGTGCAGGA
GACTTCAATAACTTTGGATGCAGTGGTGGTTTACCATCTCAAGCTTTTGAATATATTTCC
TATGCTGGTGGACTTGACACTGAAGGTGATTATCCTTATGAAGCTACAGATAATGAATGC
GAATTCAAACGTAGTCATGCTGCTGCTAAAGTTGTAAGATCCTTTAATATTACTTTCTAA
GATGAAGATGAATTGATTTATCACTTAGCTACTGCTGGCCCAATTTCTATTGCTTATCAA
GTTACTGATGACTTCTTTAAATACGATGGTGGTATTTACTCAAACCCTTACTGCTCTACT
TCTCCTGATATGGTTAATCATGCTGTCTTAGCTGTTGGTTACAACTTGACTGGACGTTAT
TATATAGTTAAGAACAGTTGGGGTGAGCATTGGGGTAATGAAGGTTACTTCAATATCGAA
TTAGGTTCAAACATGTGTGGTTTAGCTGATTGTGCCAGTTACCCTATTGTTTAAGGACAT
CACTAATATTGA


>TTHERM_00191270(protein)
MKQSIIIVALALLAIGVIARNHTFEREVSHGRHNATEQELLNIFSSYGYVANPSSERFKI
FKQRLIDIIKHNLNPHKTYTQKINKFSFYTQEELSVLNAAQNCSATAKENMAPKKKYNLK
DIPEFVDWRTKGIVTPVKNQGQCGSCWTFSTTGALESHWALHTGNAPLLLSEQQLIDCAG
DFNNFGCSGGLPSQAFEYISYAGGLDTEGDYPYEATDNECEFKRSHAAAKVVRSFNITFQ
DEDELIYHLATAGPISIAYQVTDDFFKYDGGIYSNPYCSTSPDMVNHAVLAVGYNLTGRY
YIVKNSWGEHWGNEGYFNIELGSNMCGLADCASYPIVQGHHQY


>TTHERM_00191270(gene)
ATGAAACAATCAATCATAATTGTTGCTTTGGCTCTTTTGGCAATTGGTGTTATTGCTAGA
AACCATACCTTTGAAAGAGAAGTTTCTCATGGCAGACACAACGCCACTGAGTAAGAACTT
TTGAATATCTTTTCCTCTTATGGATATGTTGCTAATCCTTCCAGTGAGAGATTTAAAATC
TTTAAACAAAGATTAATTGATATCATCAAGCATAACCTCAATCCTCATAAGACTTACACT
TAAAAAATCAACAAATTCTCATTCTACACTCAGGAAGAGTTATCTGTGTTAAACGCTGCT
TAGAATTGCTCAGCCACTGCCAAAGAAAACATGGCCCCTAAAAAGAAATACAATCTTAAG
GACATTCCTGAATTTGTTGATTGGAGAACTAAGGGTATTGTTACTCCTGTTAAGAATCAA
GGCTGTAAATATTTTATTTGATTGAATTCATATAATTTTTATCAAATCTTTTGCATTATT
AAAATCTATTTTAAAAGTCTTAAAAATAAATAATTCTACAATAAATTTCTTAATTATATA
TTAGAATGTGGTTCTTGTTGGACTTTCTCTACTACTGGTGCTCTTGAATCCCACTGGGCT
TTACACACCGGTAATGCTCCTTTATTACTCTCTGAATAATAATTGATTGACTGTGCAGGA
GACTTCAATAACTTTGGATGCAGTGGTGGTTTACCATCTCAAGCTTTTGAATATATTTCC
TATGCTGGTGGACTTGACAGTATTTCATATTTACAATTCTTTTTAGATAAATATATTGGA
AATTTTAAAAAGCTGATATGAAAACGATATTCGATTAATATTTATCATTTTAAAATATCT
AAAAAATGGATTGAACTTTCAAATTTGTTAATGAACAAGGCATACATATCTATCTTTATT
TCCTAATTCTTTTATAATTATAATATAATTACCACTCCAATTTGACAAACAAAACATAAT
AAACAATTTAAAGATATTGAATAGAAAACAGTATTTGTTTAAATAGACATATTTTTAGAT
AAATTATAAAATTAATTTTATTAGATCATTATTTATGTTATATTTTAAGAATTTTTAATT
ATATTTTAACAGCTGAAGGTGATTATCCTTATGAAGCTACAGATAATGAATGCGAATTCA
AACGTAGTCATGCTGCTGCTAAAGTTGTAAGATCCTTTAATATTACTTTCTAAGATGAAG
ATGAATTGATTTATCACTTAGCTACTGCTGGCCCAATTTCTATTGCTTATCAAGTTACTG
ATGACTTCTTTAAATACGATGGTGGTATTTACTCAAACCCTTACTGCTCTACTTCTCCTG
ATATGGTTAATCATGCTGTCTTAGCTGTTGGTTACAACTTGACTGGACGTTATTATATAG
TTAAGAACAGTTGGGGTGAGCATTGGGGTAATGAAGGTTACTTCAATATCGAATTAGGTT
CAAACATGTGTGGTTTAGCTGATTGTGCCAGTTACCCTATTGTTTAAGGACATCACTAAT
ATTGA