Identifiers and Description

Gene Model Identifier

TTHERM_01001420

Standard Name

CTH50 (cathepsin 50)

Aliases

PreTt15761 | 190.m00071 | 3820.m00292

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01001420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19731.19.997093137033517e-262papain family cysteine proteas
e containing protein (361 aa)
OxytrichaContig1254.0.g803.0013832822195203e-89Papain family cysteine proteas
e
WormBaseWBGene000007769.996162112727537e-67locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
DictyBaseDDB_G02816053.998564387823535e-58cfaD on chromosome: 3 position
4701100 to 4702904
Stentor CoeruleusSteCoe_294804.0795586671775603e-41

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01001420(coding)
ATGAAACAATAAGCTTTGTTTATTACATTAGCCATCTTCGTCTGCTTTGCCGCAGCCTAA
GAATTCGAAGTTAAGGAAGGTCTTTTAAATAATATCCTCCCCTTACACGACGACTACGTC
TTATCTCTTGCTAGATTATACAGACCTCATTTAAATGTTGAACATTTAGAATTCTAACAC
TTCAAGGAATCTGTTAGAAGAGTTAGAGAACACAACAAAAAGGTAAATGCTACCTATACT
TTATCTATCGATTCACCTTTTGCTTTCATGTCCGATGAATAATTCGTTACTGAATATCTT
GGTTCTTAAGATTGCTCTGCTACTGCTGAACTCACCCTTAAGAAGCCTATGAAGATCCAA
AATAAGAAGAACGTTTAAGTCCCTGAAAGCATTAACTGGAAAGACCTTAACAAGGTTAGC
CCTGTCAAGGATCAACAAAATTGCGGTTCTTGCTGGACCTTCTCCACTACCGGAGCTATT
GAATCTCACTATGCCATTTTTGAAGACGTCGAACCTACTTCTCTCTCTGAATAACAATTG
ATTGACTGCGCTGGTGCTTTTAATAACAATGGTTGCAGTGGTGGTTTACCCTCTTAAGCT
TTCGAATATATCAAATACAATGGTGGTATTTCTTATGAAAACTCATATTACTATATTGCT
CAAGATCAAGAATGTTAATTCAGCCCTGAAACTGTTGGTGCTAGAGTTAGGGGTGGTTCT
TTCAACATTACTTAAGGTGATGAAGATTAATTGAAGCAAGCTGTTGGTACCGTTGGTCCT
GTATCTATTGCTTTCTAGGTTATGGGTGATTTCAAGCTTTACAAGTCTGGTGTCTACTCC
AATCCTGACTGTTCAAGCTCTCCTCAAACTGTTAACCACGCTGTCTTAGCTGTCGGATAC
GGTTCTGAAAATGGTGTTGATTACTGGTACGTTAAAAACTCTTGGAGTGAATTCTGGGGT
GACGAAGGTTACTTCAAGATCCAAAGAGGTGTTAACATGTGTGGTGTCGCCACTTGTGCT
TCTTATCCTCTTCTTGAAGAATAAACCGAAGTTTCTGCTGAATCCTTCTGA


>TTHERM_01001420(protein)
MKQQALFITLAIFVCFAAAQEFEVKEGLLNNILPLHDDYVLSLARLYRPHLNVEHLEFQH
FKESVRRVREHNKKVNATYTLSIDSPFAFMSDEQFVTEYLGSQDCSATAELTLKKPMKIQ
NKKNVQVPESINWKDLNKVSPVKDQQNCGSCWTFSTTGAIESHYAIFEDVEPTSLSEQQL
IDCAGAFNNNGCSGGLPSQAFEYIKYNGGISYENSYYYIAQDQECQFSPETVGARVRGGS
FNITQGDEDQLKQAVGTVGPVSIAFQVMGDFKLYKSGVYSNPDCSSSPQTVNHAVLAVGY
GSENGVDYWYVKNSWSEFWGDEGYFKIQRGVNMCGVATCASYPLLEEQTEVSAESF


>TTHERM_01001420(gene)
ATGAAACAATAAGCTTTGTTTATTACATTAGCCATCTTCGTCTGCTTTGCCGCAGCCTAA
GAATTCGAAGTTAAGGAAGGTCTTTTAAATAATATCCTCCCCTTACACGACGACTACGTC
TTATCTCTTGCTAGATTATACAGACCTCATTTAAATGTTGAACATTTAGAATTCTAACAC
TTCAAGGAATCTGTTAGAAGAGTTAGAGAACACAACAAAAAGGTAAATGCTACCTATACT
TTATCTATCGATTCACCTTTTGCTTTCATGTCCGATGAATAATTCGTTACTGAATATCTT
GGTTCTTAAGATTGCTCTGCTACTGCTGAACTCACCCTTAAGAAGCCTATGAAGATCCAA
AATAAGAAGAACGTTTAAGTCCCTGAAAGCATTAACTGGAAAGACCTTAACAAGGTTAGC
CCTGTCAAGGATCAACAAAATTGCGGTTCTTGCTGGACCTTCTCCACTACCGGAGCTATT
GAATCTCACTATGCCATTTTTGAAGGTATAAAATTTTTTAATTTTTGGTATTTAATATTA
ATTAATTTATATTTTTAATTTAAATAGACGTCGAACCTACTTCTCTCTCTGAATAACAAT
TGATTGACTGCGCTGGTGCTTTTAATAACAATGGTTGCAGTGGTGGTTTACCCTCTTAAG
CTTTCGAATATATCAAATACAATGGTGGTATTTCTTATGAAAACTCATATTACTATATTG
CTCAAGATCAAGAATGTTAATTCAGCCCTGAAACTGTTGGTGCTAGAGTTAGGGGTGGTT
CTTTCAACATTACTTAAGGTGATGAAGATTAATTGAAGCAAGCTGTTGGTACCGTTGGTC
CTGTATCTATTGCTTTCTAGGTTATGGGTGATTTCAAGCTTTACAAGTCTGGTGTCTACT
CCAATCCTGACTGTTCAAGCTCTCCTCAAACTGTTAACCACGCTGTCTTAGCTGTCGGAT
ACGGTTCTGAAAATGGTGTTGATTACTGGTACGTTAAAAACTCTTGGAGTGAATTCTGGG
GTGACGAAGGTTACTTCAAGATCCAAAGAGGTGTTAACATGTGTGGTGTCGCCACTTGTG
CTTCTTATCCTCTTCTTGAAGAATAAACCGAAGTTTCTGCTGAATCCTTCTGA