Identifiers and Description

Gene Model Identifier

TTHERM_00925850

Standard Name

CTH49 (CaTHepsin 49)

Aliases

PreTt04392 | 165.m00110 | 3747.m00360

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 75.9%

TetraMine Data

TTHERM_00925850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07844.11.999576471039937e-58hypothetical protein (343 aa)
DictyBaseDDB_G02909571.9991939848149086e-44cprA on chromosome: 5 position
4812963 to 4814596
OxytrichaContig19008.0.g544.997755005759707e-41Papain family cysteine proteas
e
WormBaseWBGene000199862.0005131442217614e-40status:Confirmed UniProt:Q23
030 protein_id:CCD69414.1
Stentor CoeruleusSteCoe_251852.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925850(coding)
ATGTGCTGTTCATAATAAAGTGTTATTATTATTTTTATTTTAATATTGATTGTTAATGGA
CAATCAAATTTTGACAAAAATACATTTAGTTAAAAACATTAGCATCACTAAAAATTTGAA
CAATTCAAAAAAAGTTTTTCTAAGGCTTATGAAAGTGAAGAAGTTCAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAATGAAATTGACAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTATACAAAAGAAGAATTCTTGAATTTGTTCACT
GGAGCACATAAACTTGCTATCTCTGATTAAGATTAATCATAAAATAATGATAACTAAAAC
AATTAAAATACTTAATCAAATAATTAAACATCATAAGACAATTAAAACGTAAATTAATAA
AAATAAACAAAGGCTTCTAATCCTACTACTTGGGATATTAGAGTAAATGGTCCTGGTAAA
TTATAAGAAATCAAAAATTAAGGCGGATGTGGAAGTTGTTGGGCATTTTCTACTTCTGTT
GCAGTAGAGAGTTATTATTCAGCTAAAAAAAATATTACAGTGAGTCTCTCTGAATAACAG
CAAGTAGATTGCGTTTATGATCGCGATGGATGTTAGGGCGGATGGTTTACTGACTCTTTT
GATTATGCTAAACTCACTGGACTTATGACAGAATCTGCTTATCCTTATTAAGGAGCATAT
GGATCTTCATGCTAATTCTCTAATAAAACATCTATATATAAAATAAAAAGTTATTAAAAT
CTCCAAAAGAACAATTCTGTAATACAAAAAGCTGTAATGTAGAATGGTGCTGTTTCGGTA
GCAGTAGACGGTACTTATTGGGCCCACTATAAATCTGGTATTTTTACTTAAAAATAAAAA
CCTTAATTAAACCATGCTGTTGCTATTGTAGGATGGGGAAGTGGCTATTGGTTGCTTAGA
AACAGCTGGGGTACTTCATGGGGAGATTAAGGTTACATAAAAGTATCTAGCACAGGTAAT
GGTGGAATATTTACTTAATATGCATATTAACCAAATTGA


>TTHERM_00925850(protein)
MCCSQQSVIIIFILILIVNGQSNFDKNTFSQKHQHHQKFEQFKKSFSKAYESEEVQQFRF
ATFVENLNEIDRLNAEVTTAQFDISFFSDYTKEEFLNLFTGAHKLAISDQDQSQNNDNQN
NQNTQSNNQTSQDNQNVNQQKQTKASNPTTWDIRVNGPGKLQEIKNQGGCGSCWAFSTSV
AVESYYSAKKNITVSLSEQQQVDCVYDRDGCQGGWFTDSFDYAKLTGLMTESAYPYQGAY
GSSCQFSNKTSIYKIKSYQNLQKNNSVIQKAVMQNGAVSVAVDGTYWAHYKSGIFTQKQK
PQLNHAVAIVGWGSGYWLLRNSWGTSWGDQGYIKVSSTGNGGIFTQYAYQPN


>TTHERM_00925850(gene)
ATGTGCTGTTCATAATAAAGTGTTATTATTATTTTTATTTTAATATTGATTGTTAATGGA
CAATCAAATTTTGACAAAAATACATTTAGTTAAAAACATTAGCATCACTAAAAATTTGAA
CAATTCAAAAAAAGTTTTTCTAAGGCTTATGAAAGTGAAGAAGTTCAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAATGAAATTGACAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTATACAAAAGAAGAATTCTTGAATTTGTTCACT
GGAGCACATAAACTTGCTATCTCTGATTAAGATTAATCATAAAATAATGATAACTAAAAC
AATTAAAATACTTAATCAAATAATTAAACATCATAAGACAATTAAAACGTAAATTAATAA
AAATAAACAAAGGCTTCTAATCCTACTACTTGGGATATTAGAGTAAATGGTCCTGGTAAA
TTATAAGAAATCAAAAATTAAGGCGGATGTGGAAGTTGTTGGGCATTTTCTACTTCTGTT
GCAGTAGAGAGTTATTATTCAGCTAAAAAAAATATTACAGTGAGTCTCTCTGAATAACAG
CAAGTAGATTGCGTTTATGATCGCGATGGATGTTAGGGCGGATGGTTTACTGACTCTTTT
GATTATGCTAAACTCACTGGACTTATGACAGAATCTGCTTATCCTTATTAAGGAGCATAT
GGATCTTCATGCTAATTCTCTAATAAAACATCTATATATAAAATAAAAAGTTATTAAAAT
CTCCAAAAGAACAATTCTGTAATACAAAAAGCTGTAATGTAGAATGGTGCTGTTTCGGTA
GCAGTAGACGGTACTTATTGGGCCCACTATAAATCTGGTATTTTTACTTAAAAATAAAAA
CCTTAATTAAACCATGCTGTTGCTATTGTAGGATGGGGAAGTGGCTATTGGTTGCTTAGA
AACAGCTGGGGTACTTCATGGGGAGATTAAGGTTACATAAAAGTATCTAGCACAGGTAAT
GGTGGAATATTTACTTAATATGCATATTAACCAAATTGA