Identifiers and Description

Gene Model Identifier

TTHERM_00348660

Standard Name

CTH46 (CaTHepsin 46)

Aliases

PreTt05278 | 36.m00242 | 3703.m00104

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00348660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09773.19.997093137033517e-262papain family cysteine proteas
e containing protein (380 aa)
OxytrichaContig13666.0.0.g583.0005221502158484e-68Papain family cysteine proteas
e
WormBaseWBGene000091587.998932288246191e-33Uncharacterized peptidase C1-l
ike protein F26E4.3 status:C
onfirmed UniProt:P90850 pr
otein_id:CAB03007.2
DictyBaseDDB_G02885633.999374135750469e-31DDB_G0288563 on chromosome: 5
position 1689437 to 1690684
Stentor CoeruleusSteCoe_216171.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00348660(coding)
ATGAAGAATTAAAAATAAACAAGCTAATAAAGCGAAGCAGCTAAGCAAGCTTAGTTAAAC
CGCTAAAAGAAAAAAGGAAGTTCACTAGGATTTTTTAGCAAGTATTCAACTTAAATTAGT
GTTGCTTTGTTTGGTTCCCTTTTGTTAGGTGCAATTATTTCAGTAATGATACCAACTGGC
AAGAAATTAACTGAAAATGTTATTGTTGAAGAAGAAATAGCTTAACACAATGCATAAAAT
TATTCTTTTAAAATAGGTCCTAATACAATCTTTAAGGACACTACTCTTGCTTCAACTTAA
AAATTGTTTTTGAATTAAATTTCACATAAATAATCTTTAATAAGATGTCCTTCTGAATAG
GATTAAAATATAATAGATTTGTCCTTTAATTTCCATACTAAATATCCCTAGTGCGTCCGT
CCAATTGCAAATTAAGGAAAAGATTGCAGTGCTTCTTATTCAATAGCCGCTGTTTCTTCT
GTTGCTGATAGACTCTGTATGGCATCTGAGGGAGATTTTAACTTCGGTCTTAGTGCTTAA
CCTACCATCTCTTGTTATGAAAATTAATCATACAAGTGTGAAGGTGGTTATGTATCTAAA
ACTTTCTAAAAAGGAAAGACCACTGGTTTTGTCAAAGAAGAATGTTTACCTTATCATGGT
ACTGATTCAAATGAAGGATGCTCACTTATTGATAAATGTGAACATTTCAAGATTTATGAT
TATTGTGTTTCAGCAGGTTAAGAAAGCATTAAACGTGAAATCATGTTAAATGGACCTGTT
GTATCATTAATGAACGTCTTTTCTGATTTCTTAGTTTACAAGTCAGGTGTTTACCGTGTT
TTAGAAAATGCAGCAAAACTAAAAGGTCAATAAGCAGTTAAAATTATTGGTTGGGATATT
GATCCTCTTACTAAGGACTACTATTGGATAATAGAAAACTCTTGGGGAGAAGAATGGGGT
TTAAACGGTTTAGCTTACGTAGCTATGGGATAAGAAGAATTAAGATTAGAAGAATATGCT
CTTGCTGCAATTACCCTATAACAAGCCGAAACAGCTTCATCCTAATAAGCAAAAGCCTAA
AGTCAAGGATCTACTCTCAATTATGACGAAATTTGA


>TTHERM_00348660(protein)
MKNQKQTSQQSEAAKQAQLNRQKKKGSSLGFFSKYSTQISVALFGSLLLGAIISVMIPTG
KKLTENVIVEEEIAQHNAQNYSFKIGPNTIFKDTTLASTQKLFLNQISHKQSLIRCPSEQ
DQNIIDLSFNFHTKYPQCVRPIANQGKDCSASYSIAAVSSVADRLCMASEGDFNFGLSAQ
PTISCYENQSYKCEGGYVSKTFQKGKTTGFVKEECLPYHGTDSNEGCSLIDKCEHFKIYD
YCVSAGQESIKREIMLNGPVVSLMNVFSDFLVYKSGVYRVLENAAKLKGQQAVKIIGWDI
DPLTKDYYWIIENSWGEEWGLNGLAYVAMGQEELRLEEYALAAITLQQAETASSQQAKAQ
SQGSTLNYDEI


>TTHERM_00348660(gene)
ATGAAGAATTAAAAATAAACAAGCTAATAAAGCGAAGCAGCTAAGCAAGCTTAGTTAAAC
CGCTAAAAGAAAAAAGGAAGTTCACTAGGATTTTTTAGCAAGTATTCAACTTAAATTAGT
GTTGCTTTGTTTGGTTCCCTTTTGTTAGGTGCAATTATTTCAGTAATGATACCAACTGGC
AAGAAATTAACTGAAAATGTTATTGTTGAAGAAGAAATAGCTTAACACAATGCATAAAAT
TATTCTTTTAAAATAGGTCCTAATACAATCTTTAAGGTATCTTATTAAACAAAATTAAAA
ATAAATTCAAGTTGATAAATGATAAATTCATAACAACCATCTTTAATTTACTTAAAATAT
TTCTTTAAAAACTTAGGACACTACTCTTGCTTCAACTTAAAAATTGTTTTTGAATTAAAT
TTCACATAAATAATCTTTAATAAGATGTCCTTCTGAATAGGATTAAAATATAATAGATTT
GTCCTTTAATTTCCATACTAAATATCCCTAGTGCGTCCGTCCAATTGCAAATTAAGGAAA
AGATTGCAGTGCTTCTTATTCAATAGCCGCTGTTTCTTCTGTTGCTGATAGACTCTGTAT
GGCATCTGAGGGAGATTTTAACTTCGGTCTTAGTGCTTAACCTACCATCTCTTGTTATGA
AAATTAATCATACAAGTGTGAAGGTGGTTATGTATCTAAAACTTTCTAAAAAGGAAAGAC
CACTGGTTTTGTCAAAGAAGAATGTTTACCTTATCATGGTACTGATTCAAATGAAGGATG
CTCACTTATTGATAAATGTGAACATTTCAAGATTTATGATTATTGTGTTTCAGCAGGTTA
AGAAAGCATTAAACGTGAAATCATGTTAAATGGACCTGTTGTATCATTAATGAACGTCTT
TTCTGATTTCTTAGTTTACAAGTCAGGTGTTTACCGTGTTTTAGAAAATGCAGCAAAACT
AAAAGGTCAATAAGCAGTTAAAATTATTGGTTGGGATATTGATCCTCTTACTAAGGACTA
CTATTGGATAATAGAAAACTCTTGGGGAGAAGAATGGGGTTTAAACGGTTTAGCTTACGT
AGCTATGGGATAAGAAGAATTAAGATTAGAAGAATATGCTCTTGCTGCAATTACCCTATA
ACAAGCCGAAACAGCTTCATCCTAATAAGCAAAAGCCTAAAGTCAAGGATCTACTCTCAA
TTGTAAAATAATTTGTTCTTAAAATTCAATTCTAATTATTTATTTTTATTTACTAAAATA
AAAGATGACGAAATTTGA