Identifiers and Description

Gene Model Identifier

TTHERM_00908100

Standard Name

CTH44 (CaTHepsin 44)

Aliases

PreTt23713 | 162.m00042

Description

CTH44 papain family cysteine protease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 87.6%

TetraMine Data

TTHERM_00908100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06182.13.001476460448119e-154papain family cysteine proteas
e containing protein (345 aa)
OxytrichaContig13288.0.g376.996899116468003e-76Papain family cysteine proteas
e
DictyBaseDDB_G02722981.9992362000979228e-56DDB_G0272298 on chromosome: 2
position 1664020 to 1665049
WormBaseWBGene000007761.0000099287337047e-53locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_294801.1089390193121365e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00908100(coding)
ATGAGAAATATCATTTTCTTAACTTTATCAGCTTTGTGCTTAAGTGCAGTTATTGCTTAA
GATTCAAATCAAGAAATTTTAATATCTAGAGGGCTAGTTGATTATACTGATGCAGATCTT
CTAAGTATTTACTAATCTTATGGATACGAGCCTGATCCAAGTAGCGAAAGGTTTTAGCTT
TTTAAAAGTAGATTAGCTAAGATAATTGAACACAACTCTAATCCTGATAAAAAATACAGT
TAAAAAATCAACAAACTTACTTTCTAGACTGGTTCAGAACTAAAGAAGTTTAGAGCTTCA
TAAAATTGCTCAGCTACTGCTTAGGCAAACACCCGTTCATTCAGAAAATATGACTTGAGT
TAACTCCCTTAATATGTTGATTGGAGAGAGAAAGGAGTTGTAACTTAGGTTAAAAATTAA
GGTGAAGATTGTGGTTCATGTTGGGCATTTGCAGCTGTTGCAGCTCTTGAATCTCATTAT
GCTTTAAAAACTGGTAAAAAGCCAATTTAATTTTCTGAGTAGCAACTTGTTGATTGTGCT
AGAAAATTTGATACCCAAGGTTGCGATGGTGGATTACCTTCCAAAGGTTTTGAATATTTA
GCTTATGCTGGAGGAATTTAAACTGAAGCTGATTATCCTTATGAAGGAAAGGATAAAAAA
TGCAGATTTAATAGCTCAAAGGCTGTAGCTTAGGTCGAAAAATCCTTTAATATAACATTT
TAAGATGAGAATGAATTGATTTATCATTTAGCTAACTATGGTCCAGTTGCAATAGCTTAT
GAAGTTAATGATGATTTTGATAACTATGAAGATGGTGTCTTTACAAGTTCTAATTGCTCT
ACTGATCCAGAAGATGTTAATCATGCAGTTCTTGCAGTTGGCTACAATATGACAGGTAAG
TACTTCATAGTTAAAAATAGCTGGGGTAAAGATTGGGGAATGAATGGTTACTTCTATATC
GAACTTGGATCAAATATGTGTGGATTAGCAGATTGTGCAAGCTATCCTATTATTGATGAA
GACGATGATGATGAAGCCGACAAACATGATTGA


>TTHERM_00908100(protein)
MRNIIFLTLSALCLSAVIAQDSNQEILISRGLVDYTDADLLSIYQSYGYEPDPSSERFQL
FKSRLAKIIEHNSNPDKKYSQKINKLTFQTGSELKKFRASQNCSATAQANTRSFRKYDLS
QLPQYVDWREKGVVTQVKNQGEDCGSCWAFAAVAALESHYALKTGKKPIQFSEQQLVDCA
RKFDTQGCDGGLPSKGFEYLAYAGGIQTEADYPYEGKDKKCRFNSSKAVAQVEKSFNITF
QDENELIYHLANYGPVAIAYEVNDDFDNYEDGVFTSSNCSTDPEDVNHAVLAVGYNMTGK
YFIVKNSWGKDWGMNGYFYIELGSNMCGLADCASYPIIDEDDDDEADKHD


>TTHERM_00908100(gene)
ATGAGAAATATCATTTTCTTAACTTTATCAGCTTTGTGCTTAAGTGCAGTTATTGCTTAA
GATTCAAATCAAGAAATTTTAATATCTAGAGGGCTAGTTGATTATACTGATGCAGATCTT
CTAAGTATTTACTAATCTTATGGATACGAGCCTGATCCAAGTAGCGAAAGGTTTTAGCTT
TTTAAAAGTAGATTAGCTAAGATAATTGAACACAACTCTAATCCTGATAAAAAATACAGT
TAAAAAATCAACAAACTTACTTTCTAGACTGGTTCAGAACTAAAGAAGTTTAGAGCTTCA
TAAAATTGCTCAGCTACTGCTTAGGCAAACACCCGTTCATTCAGAAAATATGACTTGAGT
TAACTCCCTTAATATGTTGATTGGAGAGAGAAAGGAGTTGTAACTTAGGTTAAAAATTAA
GGTGAAGGTAAAACTAATTTTAATATATTTTTATATTATATTATAAATGTACTAATATTT
ATGTAATAATATTAGATTGTGGTTCATGTTGGGCATTTGCAGCTGTTGCAGCTCTTGAAT
CTCATTATGCTTTAAAAACTGGTAAAAAGCCAATTTAATTTTCTGAGTAGCAACTTGTTG
ATTGTGCTAGAAAATTTGATACCCAAGGTTGCGATGGTGGATTACCTTCCAAAGGTTTTG
AATATTTAGCTTATGCTGGAGGAATTTAAAGTAATTTACTTTAATTTAATTTAGGAATTA
TTTATTTAATTTAAGATATTAATAATTTTATATATTTTTTATATAAATATTTTAATATAT
TAGCTGAAGCTGATTATCCTTATGAAGGAAAGGATAAAAAATGCAGATTTAATAGCTCAA
AGGCTGTAGCTTAGGTCGAAAAATCCTTTAATATAACATTTTAAGATGAGAATGAATTGA
TTTATCATTTAGCTAACTATGGTCCAGTTGCAATAGCTTATGAAGTTAATGATGATTTTG
ATAACTATGAAGATGGTGTCTTTACAAGTTCTAATTGCTCTACTGATCCAGAAGATGTTA
ATCATGCAGTTCTTGCAGTTGGCTACAATATGACAGGTAAGTACTTCATAGTTAAAAATA
GCTGGGGTAAAGATTGGGGAATGAATGGTTACTTCTATATCGAACTTGGATCAAATATGT
GTGGATTAGCAGATTGTGCAAGCTATCCTATTATTGATGAAGACGATGATGATGAAGCCG
ACAAACATGATTGA