Identifiers and Description

Gene Model Identifier

TTHERM_01028750

Standard Name

CTH43 (cathepsin 43)

Aliases

PreTt10804 | 204.m00033

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03051 ) Peptidase C1-like family
  • ( PF00112 ) Papain family cysteine protease
  • ( PF05066 ) DNA-directed RNA polymerase, delta subunit
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01028750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06182.15.9982382972418084e-170papain family cysteine proteas
e containing protein (345 aa)
OxytrichaContig1254.0.g803.000809166761476e-75Papain family cysteine proteas
e
WormBaseWBGene000007762.0008958828286524e-54locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
DictyBaseDDB_G02838676.001502944943701e-53cprC on chromosome: 4 position
1092858 to 1094270
Stentor CoeruleusSteCoe_294805.0345753587649823e-45

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01028750(coding)
ATGAGGAAATTCATAGCTGTGATTCTTTTAGCTCTGTCTATTGCTGGCTCTTTTGCTTAA
GATTTAGACTACAAATAGTAGTACTATGAGAGCTTACTAAATGCTACGGACTCTGAACTC
TTGAAATTATTTGGGTCATACGGATTCTACCCTAACTAAAACAGTGAGAGATTTTAGCTA
TTTAAAAAAAGGGTAGCTAAAATTGCTGAACATAATTTGAATCCTAATAAGAAATACACT
CAAAAAATCAGTAAATTTACATTCTACACAAACGAAGAAATATCTAAGTTGAAGGGTTCT
CAAAATTGCTCTGCTACAGCAAAAGAAAATACTCGTATCCTTTAAACTTATGATCTTAGT
GAAATTCCTGATTACGTTGACTGGAGAGAGAAAGGTATCGTTTCTTCTGTTAAAGACTAA
GATGCTGTTGGAGATGACTGTGGTTCCTGCTGGACATTTTCTGCAACTGGAGCTATAGAA
TCTCACTTAGCTTTAAAAACTGGAAAAGCACCTTTTAATCTTTCATAGTAATAATTAGTT
GACTGTGCAGGAAAATTTGATAATCAAGGATGTGATGGTGGTTTACCTTCAAGAGCATTC
GAATATATTGCTTATGCAGGTGGTATTGAAAGTAGTCGCGATTATCCTTATAAAGGAAAA
GACGGTAAATGCAAATTCAAACCTTAAAAAGTTGTAGCAAAAGTATAAAGCTCTTTCAAC
ATTACTTTCTAAGATGAAAACGAGTTGATTTATCATTTAGCAAAGAATGGACCAGTTTCT
ATTGCCTATCAAGTCACTGATGATTTCGAAAATTATGAAGGAGGAATCTATTCTAATCCT
GAATGTTCTACTGACCCTCAAGAAGTTAACCATGCTGTATTAGCTGTAGGATATAATTTG
ACTGGTCGCTACTACATCGTCAAGAATAGTTGGGGTAAAGATTGGGGCATGGATGGTTAT
TTCTACATAGAGCTTGGCTCAAATATGTGTGGTTTAGCTGATTGTGCTAGTTATCCTATC
CTTGGTGATCAAATCATTGACTCTTAAGAAGAAGCTGATATTGATGATGAAGTTGATGAT
GAAGCTGATAGCGATGATGAAGATGACGAAGATGATGATGAAGATAGTGAAGATGATGAT
GAAGATAGTGAAGATGATGATGAAGATAGTGAAGATGATGATGAAGATAGTGAAGAAGAA
GATGATGATAGTGAGTCAGATAATGAAGACAGAATAAGAATTAACAATCATCAATAGAAT
TTCATCAATAAGATGAATCATTAGATATGA


>TTHERM_01028750(protein)
MRKFIAVILLALSIAGSFAQDLDYKQQYYESLLNATDSELLKLFGSYGFYPNQNSERFQL
FKKRVAKIAEHNLNPNKKYTQKISKFTFYTNEEISKLKGSQNCSATAKENTRILQTYDLS
EIPDYVDWREKGIVSSVKDQDAVGDDCGSCWTFSATGAIESHLALKTGKAPFNLSQQQLV
DCAGKFDNQGCDGGLPSRAFEYIAYAGGIESSRDYPYKGKDGKCKFKPQKVVAKVQSSFN
ITFQDENELIYHLAKNGPVSIAYQVTDDFENYEGGIYSNPECSTDPQEVNHAVLAVGYNL
TGRYYIVKNSWGKDWGMDGYFYIELGSNMCGLADCASYPILGDQIIDSQEEADIDDEVDD
EADSDDEDDEDDDEDSEDDDEDSEDDDEDSEDDDEDSEEEDDDSESDNEDRIRINNHQQN
FINKMNHQI


>TTHERM_01028750(gene)
ATGAGGAAATTCATAGCTGTGATTCTTTTAGCTCTGTCTATTGCTGGCTCTTTTGCTTAA
GATTTAGACTACAAATAGTAGTACTATGAGAGCTTACTAAATGCTACGGACTCTGAACTC
TTGAAATTATTTGGGTCATACGGATTCTACCCTAACTAAAACAGTGAGAGATTTTAGCTA
TTTAAAAAAAGGGTAGCTAAAATTGCTGAACATAATTTGAATCCTAATAAGAAATACACT
CAAAAAATCAGTAAATTTACATTCTACACAAACGAAGAAATATCTAAGTTGAAGGGTTCT
CAAAATTGCTCTGCTACAGCAAAAGAAAATACTCGTATCCTTTAAACTTATGATCTTAGT
GAAATTCCTGATTACGTTGACTGGAGAGAGAAAGGTATCGTTTCTTCTGTTAAAGACTAA
GATGCTGTTGGAGGTAAATTAATTATAAATAATATAATAATATTTTGTGAATTAAAACTT
GATATAATTTCTTTAATAGTTTAAAAATTAACTTAAAATTTATATATAATTTAGATGACT
GTGGTTCCTGCTGGACATTTTCTGCAACTGGAGCTATAGAATCTCACTTAGCTTTAAAAA
CTGGAAAAGCACCTTTTAATCTTTCATAGTAATAATTAGTTGACTGTGCAGGAAAATTTG
ATAATCAAGGATGTGATGGTGGTTTACCTTCAAGAGCATTCGAATATATTGCTTATGCAG
GTGGTATTGAAAGTAAGATTTTTATATAGATTTGCTCTAAAAAAATATATTTTATTATTC
TATTTCAATAAATTTTGAATAATTTTTAAATTAATAATCTTAACTAACTTAAAAATTACT
TAATAAAGGTAGTCGCGATTATCCTTATAAAGGAAAAGACGGTAAATGCAAATTCAAACC
TTAAAAAGTTGTAGCAAAAGTATAAAGCTCTTTCAACATTACTTTCTAAGATGAAAACGA
GTTGATTTATCATTTAGCAAAGAATGGACCAGTTTCTATTGCCTATCAAGTCACTGATGA
TTTCGAAAATTATGAAGGAGGAATCTATTCTAATCCTGAATGTTCTACTGACCCTCAAGA
AGTTAACCATGCTGTATTAGCTGTAGGATATAATTTGACTGGTCGCTACTACATCGTCAA
GAATAGTTGGGGTAAAGATTGGGGCATGGATGGTTATTTCTACATAGAGCTTGGCTCAAA
TATGTGTGGTTTAGCTGATTGTGCTAGTTATCCTATCCTTGGTGATCAAATCATTGACTC
TTAAGAAGAAGCTGATATTGATGATGAAGTTGATGATGAAGCTGATAGCGATGATGAAGA
TGACGAAGATGATGATGAAGATAGTGAAGATGATGATGAAGATAGTGAAGATGATGATGA
AGATAGTGAAGATGATGATGAAGATAGTGAAGAAGAAGATGATGATAGTGAGTCAGATAA
TGAAGACAGAATAAGAATTAACAATCATCAATAGAATTTCATCAATAAGATGAATCATTA
GATATGA