Identifiers and Description

Gene Model Identifier

TTHERM_00079670

Standard Name

CTH41 (CaTHepsin 41)

Aliases

PreTt10212 | 5.m00563 | 3828.m01475

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF08127 ) Peptidase family C1 propeptide
  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 87.9%

TetraMine Data

TTHERM_00079670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06986.19.997093137033517e-262papain family cysteine proteas
e containing protein (340 aa)
WormBaseWBGene000007864.999984259728227e-105locus:cpr-6 status:Confirmed
UniProt:G8JY40 protein_id
:CCD65637.1
DictyBaseDDB_G02839211.0002758036576784e-62ctsB on chromosome: 4 position
1297288 to 1298315
OxytrichaContig8855.0.g513.0006824396935516e-51Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_88351.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079670(coding)
ATGAGAAAATCTGTTATTTGCATTTTGCTTTTAGGCTGCTTGCTATCAGCTCAAGTAAAC
TGTTTCAACTTTACCTCCTTTTCTGAAAAGTTCGTTGAAGAGTTTAACAAAAGATACAAT
TCTACATGGAGAGCTGCTCGTTACTAGAAGTTTGAAGAAATGGATCCTGAAACTCTTCAA
GGACATCTCGGTGCTTTGATTGACGAACCTCTTTGGGCAAAGCTCCCTATTAAGAATGTT
GAATAAACTAATGATCCTATTCCTGAATCTTTTGACTCTCGTGAACAATGGCCTAACTGC
AATAGCATTAAGACAATTAGAGATCAATCTACTTGTGGTTCTTGCTGGGCATTTGCTGCT
ACCGAAACATATTCTGACAGAATCTGTATTGCTAGCAATCAAGAGCTTTAAACTTCAATT
TCTTCTGAAGATTTATTAGAATGTTGTGCCACCTGTGGTAATGGATGTTAAGGTGGATAT
CCAAGTGCTGCTTGGAAATACATGAAGGCTACTGGTGTCTCTACTGGTGGACTCTATGGC
GATGACTCATCTTGCAAACCCTATGTTTTCCCCCCTTGTGATCATCACGTCGTAGGACAA
TACCCTCCTTGTGGACCCATTAAGCCAACTCCCAAGTGTGTTAAATAATGTAACTCTTAA
TACACCGAAAAAACTTACTAATAAGATCTCCATCATCCTTCCAAAGTTTACTAATTACCT
AACAATGCTGAAGCTATCTAAAGAGAAATTATGGCTCATGGTCCCGTTTAGGCCTCTTTT
AGAGTTGCTAGCGATTTCCTTACTTACAAAAGTGGTGTCTACATCAGAGATCCTAAATTG
AAATACGAAGGTGGTCACTCAGTAAAAATTATTGGCTGGGGTGTTGAACAAGGTACTCCC
TATTGGCTCATTGCTAACTCCTGGAATGAAGACTGGGGTGAGAATGGTTTGTTCAAAATG
TTAAGAGGAAAGAACGAATGCGGTATCGAAGCTGAAGTTGTTGCTGGTCTTCCTTGA


>TTHERM_00079670(protein)
MRKSVICILLLGCLLSAQVNCFNFTSFSEKFVEEFNKRYNSTWRAARYQKFEEMDPETLQ
GHLGALIDEPLWAKLPIKNVEQTNDPIPESFDSREQWPNCNSIKTIRDQSTCGSCWAFAA
TETYSDRICIASNQELQTSISSEDLLECCATCGNGCQGGYPSAAWKYMKATGVSTGGLYG
DDSSCKPYVFPPCDHHVVGQYPPCGPIKPTPKCVKQCNSQYTEKTYQQDLHHPSKVYQLP
NNAEAIQREIMAHGPVQASFRVASDFLTYKSGVYIRDPKLKYEGGHSVKIIGWGVEQGTP
YWLIANSWNEDWGENGLFKMLRGKNECGIEAEVVAGLP


>TTHERM_00079670(gene)
ATGAGAAAATCTGTTATTTGCATTTTGCTTTTAGGCTGCTTGCTATCAGCTCAAGTAAAC
TGTTTCAACTTTACCTCCTTTTCTGAAAAGTTCGTTGAAGAGTTTAACAAAAGATACAAT
TCTACATGGAGAGCTGCTCGTTACTAGAAGTTTGAAGAAATGGATCCTGAAACTCTTCAA
GGACATCTCGGTGCTTTGATTGACGAACCTCTTTGGGCAAAGCTCCCTATTAAGAATGTT
GAATAAACTAATGATCCTATTCCTGAATCTTTTGACTCTCGTGAACAATGGCCTAACTGC
AATAGCATTAAGACAATTAGAGATCAATCTACTTGTGGTTCTTGCTGGGCATTTGCTGCT
ACCGAAACATATTCTGACAGAATCTGTATTGCTAGCAATCAAGAGCTTTAAACTTCAATT
TCTTCTGAAGATTTATTAGAATGTTGTGCCACCTGTGGTAATGGATGTTAAGGTGGATAT
CCAAGTGCTGCTTGGAAATACATGAAGGCTACTGGTGTCTCTACTGGTGGACTCTATGGC
GATGACTCATCTTGCAAACCCTATGTTTTCCCCCCTTGTGATCATCACGTCGTAGGACAA
TACCCTCCTTGTGGACCCATTAAGCCAACTCCCAAGTGTGTTAAATAATGTAACTCTTAA
TACACCGAAAAAACTTACTAATAAGATCTCCATCATGTAAATATATTTTTTTTAAATTAT
TTGATCGTTTACTGAGTTTTATTTTAAAAATATTTTATAATTTAAATAAAGCCTTCCAAA
GTTTACTAATTACCTAACAATGCTGAAGCTATCTAAAGAGAAATTATGGCTCATGGTCCC
GTTTAGGCCTCTTTTAGAGTTGCTAGCGATTTCCTTACTTACAAAAGTGGTGTCTACATC
AGAGATCCTAAATTGAAATACGAAGGTGGTCACTCAGTAAAAATTATTGGCTGGGGTGTT
GAACAAGGTACTCCCTATTGGCTCATTGCTAACTCCTGGAATGAAGACTGGGGTGAGAAT
GGTTTGTTCAAAATGTTAAGAGGAAAGAACGAATGCGGTATCGAAGCTGAAGTTGTTGCT
GGTCTTCCTTGA