Identifiers and Description

Gene Model Identifier

TTHERM_00641150

Standard Name

CTH40 (cathepsin 40)

Aliases

PreTt10584 | 92.m00126

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08127 ) Peptidase family C1 propeptide
  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 36.2%

TetraMine Data

TTHERM_00641150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19158.19.997093137033517e-262papain family cysteine proteas
e containing protein (347 aa)
WormBaseWBGene000007853.0001382455732556e-90locus:cpr-5 Cathepsin B-like
cysteine proteinase 5 statu
s:Confirmed UniProt:P43509
protein_id:CCD74289.1
DictyBaseDDB_G02839211.9997677415930956e-65ctsB on chromosome: 4 position
1297288 to 1298315
OxytrichaContig604.1.g921.9997255150861791e-53Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_88353.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00641150(coding)
ATGAAACGTCAAACTATCTTTATTGTCGCTGCCTTATTGTCAGCTGCTTTAACTGGTTTC
TACACCTATGAAGCCTTAAAGCACAAGGAATTCAAGTACTCCGACAGATTGAAATAACTC
GCTGAAGAAGTCAACAATGCTAACACTACCTGGAAGGCTGGTGAGAACATTAAGTGGATT
AACGCTGATATTGCTGGTGTTAAGGCTCATTTGGGTGCCTTAGAAGGTGATAACGGTGAA
AACCTCCCTGTTTCTAATGCTGTTAAGGCTGATTTACCCACTGCTTTCGATGCCAGATAA
TAATGGGGTGACAAGTGTACCTCCTTATGGGAAGTTAGAGACTAATCTAACTGTGGTTCT
TGCTGGGCTTTCGGTGCTGTCGAATCTCTTACCGATAGACATTGCATCCACCTTGGTCAA
GACATCAGACTCTCTGCCTAAAACATGTTGACTTGTTGCGCTACCTGCGGTTAAGGTTGC
AACGGTGGTTATCCCGCTTCTGCCATGAGCTACTACGTCAAGACTGGTTTGGTTACTGGT
GATTTATACAACACCACTGGTTGGTGCCAAGCTTACAGCTTCGCTCCTTGCGCTCACCAC
GTCGATACCCCCCTCTATCCTGCTTGCACTGGTGAATTACCCACCCCCAAGTGTGCTAAG
ACTTGCGACTCTGGTTCCGGTTAAACCTACACCGTCCACAAGGGTTCCAAGGCTTACTCT
GTTGGTAAGACCCAAGAAGCCATCATGACTGAAATCTAAACCAACGGTCCCGTTGAAGCT
GCCTTCACTGTTTATGAAGATTTCTTAAACTACAAGAGCGGTGTCTACAAACACGTTACT
GGTAAGGCTTTGGGTGGTCACGCCATCAAGATTGTTGGTTGGGGTGTTGAAAACAATACT
CCTTACTGGATTGTCGTTAACTCTTGGAACCAAACCTGGGGTGACAATGGTACCTTCAAG
ATCTTAAGAGGCAAGAACGAATGTGGTATTGAAGCTCAAGTCGTTACTGCTCTCCCCTTA
AACTGA


>TTHERM_00641150(protein)
MKRQTIFIVAALLSAALTGFYTYEALKHKEFKYSDRLKQLAEEVNNANTTWKAGENIKWI
NADIAGVKAHLGALEGDNGENLPVSNAVKADLPTAFDARQQWGDKCTSLWEVRDQSNCGS
CWAFGAVESLTDRHCIHLGQDIRLSAQNMLTCCATCGQGCNGGYPASAMSYYVKTGLVTG
DLYNTTGWCQAYSFAPCAHHVDTPLYPACTGELPTPKCAKTCDSGSGQTYTVHKGSKAYS
VGKTQEAIMTEIQTNGPVEAAFTVYEDFLNYKSGVYKHVTGKALGGHAIKIVGWGVENNT
PYWIVVNSWNQTWGDNGTFKILRGKNECGIEAQVVTALPLN


>TTHERM_00641150(gene)
ATGAAACGTCAAACTATCTTTATTGTCGCTGCCTTATTGTCAGCTGCTTTAACTGGTTTC
TACACCTATGAAGCCTTAAAGCACAAGGAATTCAAGTACTCCGACAGATTGAAATAACTC
GCTGAAGAAGTCAACAATGCTAACACTACCTGGAAGGCTGGTGAGAACATTAAGTGGATT
AACGCTGATATTGCTGGTGTTAAGGCTCATTTGGGTGCCTTAGAAGGTGATAACGGTGAA
AACCTCCCTGTTTCTAATGCTGTTAAGGCTGATTTACCCACTGCTTTCGATGCCAGATAA
TAATGGGGTGACAAGTGTACCTCCTTATGGGAAGTTAGAGACTAATCTAACTGTGGTTCT
TGCTGGGCTTTCGGTGCTGTCGAATCTCTTACCGATAGACATTGCATCCACCTTGGTCAA
GACATCAGACTCTCTGCCTAAAACATGTTGACTTGTTGCGCTACCTGCGGTTAAGGTTGC
AACGGTGGTTATCCCGCTTCTGCCATGAGCTACTACGTCAAGACTGGTTTGGTTACTGGT
GATTTATACAACACCACTGGTTGGTGCCAAGCTTACAGCTTCGCTCCTTGCGCTCACCAC
GTCGATACCCCCCTCTATCCTGCTTGCACTGGTGAATTACCCACCCCCAAGTGTGCTAAG
ACTTGCGACTCTGGTTCCGGTTAAACCTACACCGTCCACAAGGGTTCCAAGGCTTACTCT
GTTGGTAAGACCCAAGAAGCCATCATGACTGAAATCTAAACCAACGGTCCCGTTGAAGCT
GCCTTCACTGTTTATGAAGATTTCTTAAACTACAAGAGCGGTGTCTACAAACACGTTACT
GGTAAGGCTTTGGGTGGTCACGCCATCAAGATTGTTGGTTGGGGTGTTGAAAACAATACT
CCTTACTGGATTGTCGTTAACTCTTGGAACCAAACCTGGGGTGACAATGGTACCTTCAAG
ATCTTAAGAGGCAAGAACGAATGTGGTATTGAAGCTCAAGTCGTTACTGCTCTCCCCTTA
AACTGA