Identifiers and Description

Gene Model Identifier

TTHERM_00445920

Standard Name

CTH4 (CaTHepsin 4 )

Aliases

PreTt03861 | 51.m00227 | 3704.m00082

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08773 ) Cathepsin C exclusion domain
  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 90%

TetraMine Data

TTHERM_00445920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10859.29.997093137033517e-262papain family cysteine proteas
e containing protein (597 aa)
OxytrichaContig18805.0.g122.0004062814618821e-57Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_284102.1705220113036395e-29
DictyBaseDDB_G02885632.0009605191578312e-25DDB_G0288563 on chromosome: 5
position 1689437 to 1690684
WormBaseWBGene000007821.0000422327488734e-24locus:cpr-2 status:Partially
_confirmed UniProt:O45466
protein_id:CAB04322.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00445920(coding)
ATGGTTAAAAGTAGATTAGCTGCAATATTGCTCTTGTTTGCAGTCTAAAGCTTATTGGTA
TAAGCTGATTTACCTGTTCATTGCGTTAGATCTTAAATAACTGGTAAATGGTTACTTAAA
GAAGGAAAAGTTCTAGCATCAAGTAATAACAAGCCTGTTTCTTGTGGTCATTAAATTCCT
GATAAAGCAGAATCAAGCAATAGCGCCATGGGTGGTGTTTTAACTGAAGTTGAAAGAGAG
TATGAAGTATTTTTAGATGAAGACTTCACAGTAAGAGGAAAAGAAGGTAAAGGTAGATGG
ACCTTAGTCTATGATGAAGGTTGGGAAATTGAATATAATGGAGTTAAATATACTCACTTT
TTTAAGTATGCTAAAGACGACTCAGGATAATATAAATCTGTTTGCTCTCAAACCTTAGTT
GGTTGGTTCAACCACATTCAAAAAAAATCTAGAGGATGCTCTTAAGCTATTAAAGCAGAC
GCATCTTAAGAATTCTCAGATAATGTATAGTAAGCTCATGTTGTATAACCCAAGGAAACT
CAATACATTTTTTCTGAAATTTCATCTACAATGAATAAATTAAGCAGCTAATAAGAATAA
TAAAAAAGCTAAAAAATTAATGCTTCTAACTCTCTTAAAAGATAATAGCTTTCTTCCAAA
AACAAGTTCCATCAATCAATTTACTTGAAGCCTCATGAAAATGTATTTGCTTAAATGAAA
CAAACACCTGCAACATTATTAAACCATTAAGAAATCGTTAAGAGATTAAACTCAATTAAA
GGAAGTACATGGTAAGCTAAAGTTCCTTCTTTCATAAGCAAAATGAGTCTTGAGTAGATG
AACACAAGAGCTGGTCTAAGAATGGATAAGCCTAAATTCAGTTACGACAACAAATAAGGC
TCCTTTATTTAAAAATCATCATCTTCCTTGAGAGGTAACAAAGCAACTACCGATTATGCC
CACTTTTCTATGGAGAACATATCAGATCTTCCTAAGTCTTTTGATTGGGCTGAATATATC
CATGCTCCTCGTTCTTAAGAAGATTGTGGAAGTTGCTATGCTATTGCCACAACTTCTATG
CTTTCATCTCGTTTGTGGATTAAATACGGTGATAATACTTAACTCTCACCCCAACACTCC
TTGGCATGTAATTATTATAACTAAGGTTGCGATGGTGGTTATGGATTTTTGGTAAGCAAA
TTTTACAGTGAGTTCGAAGCTGTCCCTGAAAGTTGTCATCCTTATGAAGCTAGAGATGGT
TAATGCAATCATTGCAATGTCGAATCTCTCAGTGAAGTATTCACAGTTACTGATTACGAA
TATATCGGTGGATCATATGGAAAATCAACTGAAAGATTGATGATGGAAGAAATATATAAA
AACGGTCCTATTGTAGTCAGTTTTGAACCTAAAATGGATTTCATGTATTACAACAAGGGT
ATATATCACTCAGTTGATGCTAACCAATGGATTTAAAACAATGAAGAAAATCCTGTCTGG
TAAAAAGTTGATCACTCAGTTCTCTGCTATGGTTGGGGAGAAGATGAAAACGGCAAATTC
TGGTTATTACAAAACTCATGGGGTGAAGAATGGGGTGAGAATGGTAACTTCAGAATGAGA
AGAGGAACTGATGAATCAAACATTGAAAGTATGGGTGAAAGAGCTAATATTGTAAAGACT
GCAAGAAAATCTCCTAACACAACTGAATTTTCATCAACTTATTCATCTCACTCAGACAAA
TACTTTGTTGAAAAATCTAAAAGAAAATAATGA


>TTHERM_00445920(protein)
MVKSRLAAILLLFAVQSLLVQADLPVHCVRSQITGKWLLKEGKVLASSNNKPVSCGHQIP
DKAESSNSAMGGVLTEVEREYEVFLDEDFTVRGKEGKGRWTLVYDEGWEIEYNGVKYTHF
FKYAKDDSGQYKSVCSQTLVGWFNHIQKKSRGCSQAIKADASQEFSDNVQQAHVVQPKET
QYIFSEISSTMNKLSSQQEQQKSQKINASNSLKRQQLSSKNKFHQSIYLKPHENVFAQMK
QTPATLLNHQEIVKRLNSIKGSTWQAKVPSFISKMSLEQMNTRAGLRMDKPKFSYDNKQG
SFIQKSSSSLRGNKATTDYAHFSMENISDLPKSFDWAEYIHAPRSQEDCGSCYAIATTSM
LSSRLWIKYGDNTQLSPQHSLACNYYNQGCDGGYGFLVSKFYSEFEAVPESCHPYEARDG
QCNHCNVESLSEVFTVTDYEYIGGSYGKSTERLMMEEIYKNGPIVVSFEPKMDFMYYNKG
IYHSVDANQWIQNNEENPVWQKVDHSVLCYGWGEDENGKFWLLQNSWGEEWGENGNFRMR
RGTDESNIESMGERANIVKTARKSPNTTEFSSTYSSHSDKYFVEKSKRKQ


>TTHERM_00445920(gene)
ATGGTTAAAAGTAGATTAGCTGCAATATTGCTCTTGTTTGCAGTCTAAAGCTTATTGGTA
TAAGCTGATTTACCTGTTCATTGCGTTAGATCTTAAATAACTGGTAAATGGTTACTTAAA
GAAGGAAAAGTTCTAGCATCAAGTAATAACAAGCCTGTTTCTTGTGGTCATTAAATTCCT
GATAAAGCAGAATCAAGCAATAGCGCCATGGGTGGTGTTTTAACTGAAGTTGAAAGAGAG
TATGAAGTATTTTTAGATGAAGACTTCACAGTAAGAGGAAAAGAAGGTAAAGGTAGATGG
ACCTTAGTCTATGATGAAGGTTGGGAAATTGAATATAATGGAGTTAAATATACTCACTTT
TTTAAGTATGCTAAAGACGACTCAGGATAATATAAATCTGTTTGCTCTCAAACCTTAGTT
GGTTGGTTCAACCACATTCAAAAAAAATCTAGAGGATGCTCTTAAGCTATTAAAGCAGAC
GCATCTTAAGAATTCTCAGATAATGTATAGTAAGCTCATGTTGTATAACCCAAGGAAACT
CAATACATTTTTTCTGAAATTTCATCTACAATGAATAAATTAAGCAGCTAATAAGAATAA
TAAAAAAGCTAAAAAATTAATGCTTCTAACTCTCTTAAAAGATAATAGCTTTCTTCCAAA
AACAAGTTCCATCGTAATTAATATTATTATAGCTTTTTTTTATTTATTATGCTTAGAGTT
TACGAAAAAAAAATATGAAATAATATGTTAAAAAAAAACAAAATTTGATTAATTTTTATA
GTGGCATATGACCGTTTTTAAAAGCAAGTCTTGTATATTAATGGAAATGCAAAATTATTG
TTAAATAAGTAAAAATTTAAACTAATTTTATTAAAATTTTAGAATCAATTTACTTGAAGC
CTCATGAAAATGTATTTGCTTAAATGAAACAAACACCTGCAACATTATTAAACCATTAAG
AAATCGTTAAGAGATTAAACTCAATTAAAGGAAGTACATGGTAAGCTAAAGTTCCTTCTT
TCATAAGCAAAATGAGTCTTGAGTAGATGAACACAAGAGCTGGTCTAAGAATGGATAAGC
CTAAATTCAGTTACGACAACAAATAAGGCTCCTTTATTTAAAAATCATCATCTTCCTTGA
GAGGTAACAAAGCAACTACCGATTATGCCCACTTTTCTATGGAGAACATATCAGATCTTC
CTAAGTCTTTTGATTGGGCTGAATATATCCATGCTCCTCGTTCTTAAGAAGATTGTGGAA
GTTGCTATGCTATTGCCACAACTTCTATGCTTTCATCTCGTTTGTGGATTAAATACGGTG
ATAATACTTAACTCTCACCCCAACACTCCTTGGCATGTAATTATTATAACTAAGGTTGCG
ATGGTGGTTATGGATTTTTGGTAAGCAAATTTTACAGTGAGTTCGAAGCTGTCCCTGAAA
GTTGTCATCCTTATGAAGCTAGAGATGGTTAATGCAATCATTGCAATGTCGAATCTCTCA
GTGAAGTATTCACAGTTACTGATTACGAGTAAATAATATATATTTAAAAAGCATGTTTAA
AATTTAATTTATTTTGATATTTTAAAGATATATCGGTGGATCATATGGAAAATCAACTGA
AAGATTGATGATGGAAGAAATATATAAAAACGGTCCTATTGTAGTCAGTTTTGAACCTAA
AATGGATTTCATGTATTACAACAAGGGTATATATCACTCAGTTGATGCTAACCAATGGAT
TTAAAACAATGAAGAAAATCCTGTCTGGTAAAAAGTTGATCACTCAGTTCTCTGCTATGG
TTGGGGAGAAGATGAAAACGGCAAATTCTGGTTATTACAAAACTCATGGGGTGAAGAATG
GGGTGAGAATGGTAACTTCAGGTAAAGATTAAATATTTATCATATTTTTTATTTTAACAA
TTTTGCTTTTATAATAGAATGAGAAGAGGAACTGATGAATCAAACATTGAAAGTATGGGT
GAAAGAGCTAATATTGTAAAGACTGCAAGAAAATCTCCTAACACAACTGAATTTTCATCA
ACTTATTCATCTCACTCAGACAAATACTTTGTTGAAAAATCTAAAAGAAAATAATGA