Identifiers and Description

Gene Model Identifier

TTHERM_00823810

Standard Name

CTH37 (cathepsin 37)

Aliases

PreTt20451 | 141.m00108 | 3682.m00042

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF02420 ) Insect antifreeze protein repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 76.5%

TetraMine Data

TTHERM_00823810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_206730
Tetrahymena borealisEI9_18149.19.997093137033517e-262papain family cysteine proteas
e containing protein (590 aa)
OxytrichaContig13243.0.g779.997093137033517e-262Papain family cysteine proteas
e
DictyBaseDDB_G02801879.001511723580574e-81DDB_G0280187 on chromosome: 3
position 3078456 to 3080086
WormBaseWBGene000007881.999129405549486e-73locus:cpz-1 status:Confirmed
UniProt:G5EGP8 protein_id
:CCD70407.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00823810(coding)
ATGAATAAAGCTGCTAAATTTATAGTTCTAATTAGTATCATTTATTTAGGAGTTATTGCA
AAAAATAACAATTAAGGACATATCCATTCAAAAACATTCTAGTCTAAGGTAATTAATCCT
CTCTAGTACGTTAAAGAGCTTCCTGATACTTGGCTTTGGAGCAATGTTAATGGCATTGAC
TATTTGACTTTCGGACGTAACTAACATATCCCATAATACTGTGGTTCTTGCTGGGCTTTT
GCAGCTACTTCAGCTCTTTCAGATAGAATTAAAATAGCCAGAAATGCTACATTCCCTGAT
ATCAACCTGTCTCCTCAATTCTTATTAAGTTGTTAACAAGATTAGGAAGATTTAGGATGT
AATGGTGGTGATGCTAGAAATGCATTTGCTTGGATTCATTCTAATAATATTACAGATGAA
ACTTGCTCGGTTTACAGAGCAAAGGGATATACTAATGGACAAGCTTGTACTTAATAAATA
AAATGCCAAAATTGCTCCCCCCTTATTGGATGCAAGAGTCAAACCAACTATTAGATTTAT
GGTGTTTCAGAGTATGGTGATGTTTCAGGTGAAGAAGCTATGATGTAAGAAATTTATCAG
AGAGGTCCTATTACTTGTGGAATTGCTGTTCCTGATGCTTTATTAAATTATACTGGAGGA
ATTTTTTATGACAGAACTGGAGATTTAGAAATCGAACATGATATCTCTGTTGTTGGATAC
GGAACTCTCAAAAATGGAACTAAGTACTGGATGGTTAGAAACTCTTGGGGTACTTATTGG
GGTGAAAATGGTTTCTTTAGAATAATTCGAGGTGTTAATAATTTAAATATTGAATCTGCT
TGTGCTTGGGCTGTACCAAGAGACACTTGGTCAAATGATGTTCGTAATCTTACTACTGTA
AACGAAAAACCTGTTTCTAACTTTTAAAAATCATCAGGCTGTAAAAGAGAAAGCATTTTC
AATCTGCCAGAAAAAATAAAATCTTCTCGTCCACATGAATACTTGAAAGCTGCAGACTTA
CCTAAGAGTTTTACTTGGTAAAATGCATATGGTAAAAATTATCTTTCAATAACAAGAAAT
CAACATATTCCTGTTTATTGTGGATCTTGCTGGGCTCATGGTGCCACTTCTTCTATAGCT
GATAGAATTAATATTGCAAGAAATGGTACATTCCCCTAAGTTGCTCTTTCACCATAAGTT
ATTATTAATTGCAAAGCAGGCGGTTCTTGCTCAGGTGGTAATGCTATGGGTGTATATGAA
TTCGGACACACTAATGGTATTCCTGAAGAATCCTGCTAATAATATGTTGCAAAAAATCCT
GAAAAATTTACATGCTCTGATATACAACAGTGCATGAATTGTGCTCCTTCGGAAAAAGGA
TAAAATTGCTGGGCTTAGCCTAATTTTAAGAAATGGAAAATTTCAGAATATGGTTATGTA
AAAGGTGCTGATTAAATGAAAGCAGAAATATTTGCTAGAGGTCCTATTGGTTGCGGTATT
GAAGCCACTTTAAAACTAGAAAACTACTCTGGAGGTATTTTTGAATAAAATCTATTATTT
ACTTCCCTTAATCACGAAGTAGCTGTCGTTGGTTGGGGTGTAGATGAAGCTACAGGTGTT
GAATATTGGATAGCAAGAAATTCTTGGGGTTCTTACTGGGGAGAAAATGGTTACTTCAGA
ATTAGAATGCATAAAAATAACAACGGTATAGAAAAGGAATGTGATTGGGGTGTTCCAATA
GTTGAAGAAGAAGAAGTAACTGTTGAAGCATATTGA


>TTHERM_00823810(protein)
MNKAAKFIVLISIIYLGVIAKNNNQGHIHSKTFQSKVINPLQYVKELPDTWLWSNVNGID
YLTFGRNQHIPQYCGSCWAFAATSALSDRIKIARNATFPDINLSPQFLLSCQQDQEDLGC
NGGDARNAFAWIHSNNITDETCSVYRAKGYTNGQACTQQIKCQNCSPLIGCKSQTNYQIY
GVSEYGDVSGEEAMMQEIYQRGPITCGIAVPDALLNYTGGIFYDRTGDLEIEHDISVVGY
GTLKNGTKYWMVRNSWGTYWGENGFFRIIRGVNNLNIESACAWAVPRDTWSNDVRNLTTV
NEKPVSNFQKSSGCKRESIFNLPEKIKSSRPHEYLKAADLPKSFTWQNAYGKNYLSITRN
QHIPVYCGSCWAHGATSSIADRINIARNGTFPQVALSPQVIINCKAGGSCSGGNAMGVYE
FGHTNGIPEESCQQYVAKNPEKFTCSDIQQCMNCAPSEKGQNCWAQPNFKKWKISEYGYV
KGADQMKAEIFARGPIGCGIEATLKLENYSGGIFEQNLLFTSLNHEVAVVGWGVDEATGV
EYWIARNSWGSYWGENGYFRIRMHKNNNGIEKECDWGVPIVEEEEVTVEAY


>TTHERM_00823810(gene)
ATGAATAAAGCTGCTAAATTTATAGTTCTAATTAGTATCATTTATTTAGGAGTTATTGCA
AAAAATAACAATTAAGGACATATCCATTCAAAAACATTCTAGTCTAAGGTAATTAATCCT
CTCTAGTACGTTAAAGAGCTTCCTGATACTTGGCTTTGGAGCAATGTTAATGGCATTGAC
TATTTGACTTTCGGACGTAACTAACATATCCCATAATACTGTGGTTCTTGCTGGGCTTTT
GCAGCTACTTCAGCTCTTTCAGATAGAATTAAAATAGCCAGAAATGCTACATTCCCTGGT
AAATATAAATAAAGCTACCCCATAAAATATATTTTTGAATATATTTTTTTAGGCTATTCA
AATAAAAATGGAATTTTTGAAAATAAGGTTTTTGTAAAATTTACTTTAAGTAGTTGATTG
CATTTCTTAATTTTTAAAGATTTGTTAAAGTACTATCAATTACATTTCTTAAAAAATTCT
TAATTTTCCTAACCACAAATTATGATTTAATTATTTTAATAACAAAAAAAAGCCACAGAA
TTCATTAAATTAAATCGATATAAATACAAAATTTACACCTGCATGAATTAAATTTAAATA
CAATACTAAATTATTAATTTATAAAAAGTTAAAGGTGTTTTTAATTTACTTTACATTAAT
TAATTATTAACTTGACAACAAAAATTCTTTAATTTTTCTCTTCAATTTTATAATTTAATA
ACCTTATTTCATAAATTTACATTATTACATCTGTTTTTGTTTTTCTTTACAAAGTGAAAA
TTTTTAATTGAATTTAAAATTATTAACTAGATATCAACCTGTCTCCTCAATTCTTATTAA
GTTGTTAACAAGATTAGGAAGATTTAGGATGTAATGGTGGTGATGCTAGAAATGCATTTG
CTTGGATTCATTCTAATAATATTACAGATGAAACTTGCTCGGTTTACAGAGCAAAGGGAT
ATACTAATGGACAAGCTTGTACTTAATAAATAAAATGCCAAAATTGCTCCCCCCTTATTG
GATGCAAGAGTCAAACCAACTATTAGATTTATGGTGTTTCAGAGTATGGTGATGTTTCAG
GTGAAGAAGCTATGATGTAAGAAATTTATCAGAGAGGTCCTATTACTTGTGGAATTGCTG
TTCCTGATGCTTTATTAAATTATACTGGAGGAATTTTTTATGACAGAACTGGAGATTTAG
AAATCGAACATGATATCTCTGTTGTTGGATACGGAACTCTCAAAAATGGAACTAAGTACT
GGATGGTTAGAAACTCTTGGGGTACTTATTGGGGTGAAAATGGTTTCTTTAGAATAATTC
GAGGTGTTAATAATTTAAATATTGAATCTGCTTGTGCTTGGGCTGTACCAAGAGACACTT
GGTCAAATGATGTTCGTAATCTTACTACTGTAAACGAAAAACCTGTTTCTAACTTTTAAA
AATCATCAGGCTGTAAAAGAGAAAGCATTTTCAATCTGCCAGAAAAAATAAAATCTTCTC
GTCCACATGAATACTTGAAAGCTGCAGACTTACCTAAGAGTTTTACTTGGTAAAATGCAT
ATGGTAAAAATTATCTTTCAATAACAAGAAATCAACATATTCCTGTTTATTGTGGATCTT
GCTGGGCTCATGGTGCCACTTCTTCTATAGCTGATAGAATTAATATTGCAAGAAATGGTA
CATTCCCCTAAGTTGCTCTTTCACCATAAGTTATTATTAATTGCAAAGCAGGCGGTTCTT
GCTCAGGTGGTAATGCTATGGGTGTATATGAATTCGGACACACTAATGGTATTCCTGAAG
AATCCTGCTAATAATATGTTGCAAAAAATCCTGAAAAATTTACATGCTCTGATATACAAC
AGTGCATGAATTGTGCTCCTTCGGAAAAAGGATAAAATTGCTGTAAATTAATTTTTAGTT
TAAAAAAAATAGAACCATTAAATTTCTTACACTTTCTGAAGTAAATATGATTAATTAAAT
TTTTAAATAAAAAAGGGGCTTAGCCTAATTTTAAGAAATGGAAAATTTCAGAATATGGTT
ATGTAAAAGGTGCTGATTAAATGAAAGCAGAAATATTTGCTAGAGGTCCTATTGGTTGCG
GTATTGAAGCCACTTTAAAACTAGAAAACTACTCTGGAGGTATTTTTGAATAAAATCTAT
TATTTACTTCCCTTAATCACGAAGTAGCTGTCGTTGGTTGGGGTGTAGATGAAGCTACAG
GTGTTGAATATTGGATAGCAAGAAATTCTTGGGGTTCTTACTGGGGAGAAAATGGTTACT
TCAGAATTAGAATGCATAAAAATAACAACGGTATAGAAAAGGAATGTGATTGGGGTGTTC
CAATAGTTGAAGAAGAAGAAGTAACTGTTGAAGCATATTGA