Identifiers and Description

Gene Model Identifier

TTHERM_00102770

Standard Name

CTH36 (cathepsin 36)

Aliases

PreTt22977 | 7.m00426

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 81.1%

TetraMine Data

TTHERM_00102770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_206730
Tetrahymena borealisEI9_00330.19.997093137033517e-262papain family cysteine proteas
e containing protein (582 aa)
OxytrichaContig13243.0.g779.997093137033517e-262Papain family cysteine proteas
e
WormBaseWBGene000007888.999309133990366e-84locus:cpz-1 status:Confirmed
UniProt:G5EGP8 protein_id
:CCD70407.1
DictyBaseDDB_G02801879.999776257620412e-83DDB_G0280187 on chromosome: 3
position 3078456 to 3080086

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00102770(coding)
ATGAAACTAAATATATTGATTTTATCTCTGTTAATAGTTGGAGCTATTTGTGTCGATGAC
TGGATTGACAATAGCAAAAACTACAAGCCCTTGATCAAGAGTGAAATGAGCTTCAACTCT
GAACTTCCCGAAAACTTTTTCTGGGGTGATGTTGATGGAGTTAACTACTTGACTGTAACT
AAAAATCAACATATTCCCTAATACTGTGGTTCATGCTGGGCTTTCACTGCTACCAGTACT
CTTTCTGATAGAATTAAAATTGCCAGAAAAGCTGCTTTCCCTGACATTTTAATTTCTCCT
TAAGTTTTGATTTCCTGCGATGACTTCAGCAATGGTTGTCACGGTGGTAACATTCTTACT
TCTTACTAATGGATCGCATAAAACAACATTACTGATGAAACTTGTTCTCCTTACCAAGCT
TATGGACACGATAACGGAGTTGGATGTTCCGCATAAATTAAATGTAAGAACTGTTTACCA
GGTAAAGGTTGTTGGGCTTAAGATAACGCTAAGATTTATTCAGTTGAAGAACATGGTCAA
GTTAATGGTGAAGAAAATATGATGTAAGAAATATTCAATAGAGGTCCTATTGGTTGCGGA
ATCGCTTCAAATGACTATTTAAGATATAACTACACAGGAGGTATTTACGTCAATACTACT
GAAGTAGACTACCATAATCACGCTATCTCTGTTGTAGGTTGGGGTGTTGAAAATGGAACC
AAGTACTGGATTGTCAGAAACTCTTGGGGAAGCTATTGGGGTGAAAAGGGCTACTTCAGA
TTAGTTAGAGGTATTAATTCTTTGAATATCGAAAGTGATTGTGCATGGGCTGTTCCTAAA
GATACCTGGACTAATGATGTTAGAAATACTACTGCTAGCAACACCAACAGCTAATCTAAC
TTCAGATAATTACATGATTGTGTTAGACAAGAAAATAATCAAAAAGACCAAGTCATTCTT
AGTCCTCTTCCTCACTAATATTTAAATGGAGCCGTTCTTCCTAAAAGCTGGGACTGGAGA
AATATTTCTGGAGTTAACTATCTCTCAGTCACTCGTAACTAGCACATTCCTTAATACTGC
GGTTCTTGCTGGGCTCACGGTACCACATCTTCTATTGCTGATAGAATCAATATTGCTAGA
AACAGAACTTTCCCTGATATTGAATTATCAGTTCAAGCCATTATTAATTGTAAAGCTGGT
GGTTCTTGCAATGGTGGTTAACCCATTTCTGTTTACTCATTTGCACATAAGAAGGGTGTT
CCTGAAGAATCTTGCCAAAACTATGTTGCTAAGAATCCTTAAAAGTTCTCTTGTTCTGAT
ATTTAAAGATGTATGGATTGCACCAAGCCTGCTCCTACTAATACTACAGTTAACCCTGGT
AGATGTTGGGCTGTTGATAACTACGAAAACTGGAAGGTTGGTGAATATGGCACAGTTTCT
GGAGCTGATAAGATGAAGGCTGAAATCTTTGCTAGAGGTCCAATTTCCTGCGGTATTGCT
GTCACTAATAAGTTCGAAGCTTACACTGGTGGTGTTTACTCTGAAAAGAGCCTTACTCGT
ATCAATCACGAAATTGCTGTTGTTGGTTGGGGTGTTGATGAAACCACTAACACTGAGTAT
TGGATTGGTAGAAATTCTTGGGGTACTTACTGGGGTGAAGATGGTTTCTTCAGAATTAAA
ATGCACTCAGAAAATCTTAAAATTGAAACTGACTGCTCTTGGGGTGTTCCAGTTGTAGAA
AAATGA


>TTHERM_00102770(protein)
MKLNILILSLLIVGAICVDDWIDNSKNYKPLIKSEMSFNSELPENFFWGDVDGVNYLTVT
KNQHIPQYCGSCWAFTATSTLSDRIKIARKAAFPDILISPQVLISCDDFSNGCHGGNILT
SYQWIAQNNITDETCSPYQAYGHDNGVGCSAQIKCKNCLPGKGCWAQDNAKIYSVEEHGQ
VNGEENMMQEIFNRGPIGCGIASNDYLRYNYTGGIYVNTTEVDYHNHAISVVGWGVENGT
KYWIVRNSWGSYWGEKGYFRLVRGINSLNIESDCAWAVPKDTWTNDVRNTTASNTNSQSN
FRQLHDCVRQENNQKDQVILSPLPHQYLNGAVLPKSWDWRNISGVNYLSVTRNQHIPQYC
GSCWAHGTTSSIADRINIARNRTFPDIELSVQAIINCKAGGSCNGGQPISVYSFAHKKGV
PEESCQNYVAKNPQKFSCSDIQRCMDCTKPAPTNTTVNPGRCWAVDNYENWKVGEYGTVS
GADKMKAEIFARGPISCGIAVTNKFEAYTGGVYSEKSLTRINHEIAVVGWGVDETTNTEY
WIGRNSWGTYWGEDGFFRIKMHSENLKIETDCSWGVPVVEK


>TTHERM_00102770(gene)
ATGAAACTAAATATATTGATTTTATCTCTGTTAATAGTTGGAGCTATTTGTGTCGATGAC
TGGATTGACAATAGCAAAAACTACAAGCCCTTGATCAAGAGTGAAATGAGCTTCAACTCT
GAACTTCCCGAAAACTTTTTCTGGGGTGATGTTGATGGAGTTAACTACTTGACTGTAACT
AAAAATCAACATATTCCCTAATACTGTGGTTCATGCTGGGCTTTCACTGCTACCAGTACT
CTTTCTGATAGAATTAAAATTGCCAGAAAAGCTGCTTTCCCTGACATTTTAATTTCTCCT
TAAGTTTTGATTTCCTGCGATGACTTCAGCAATGGTTGTCACGGTGGTAACATTCTTACT
TCTTACTAATGGATCGCATAAAACAACATTACTGATGAAACTTGTTCTCCTTACCAAGCT
TATGGACACGATAACGGAGTTGGATGTTCCGCATAAATTAAATGTAAGAACTGTTTACCA
GGTAAAGGTTGTTGGGCTTAAGATAACGCTAAGATTTATTCAGTTGAAGAACATGGTCAA
GTTAATGGTGAAGAAAATATGATGTAAGAAATATTCAATAGAGGTCCTATTGGTTGCGGA
ATCGCTTCAAATGACTATTTAAGATATAACTACACAGGAGGTATTTACGTCAATACTACT
GAAGTAGACTACCATAATCACGCTATCTCTGTTGTAGGTTGGGGTGTTGAAAATGGAACC
AAGTACTGGATTGTCAGAAACTCTTGGGGAAGGTATTATTTATTTATTAATTTATATAAT
TATTCATTCATTTTCATTCAGATTTATTTGTTTGATAAGTTTTAATTGACATCCATGTAA
TTTTATAAAGTTTTGTTTTTGTTTTTTTAGCTAATTAATTATTTTTTAAGGAAAATAATA
AGGAAAGAAAAAGAAATTAATATCTTAGATTGATTTTTCTTATTCTTTTAATTTTCTTTC
TTTTTTACAGCCAAACGTTTGTATTCTGTATAACCTTTTCTTATAAATTGCTTACTTTTT
ATTTCAGCTTGATCCTAAAAATAGTTATCAGCAAAACATTTTTGGATGTTTATTGAATTA
GAAATTGACGTTTTAAATAATAAAAATTTTTAAAAAAAGCTATTGGGGTGAAAAGGGCTA
CTTCAGATTAGTTAGAGGTATTAATTCTTTGAATATCGAAAGTGATTGTGCATGGGCTGT
TCCTAAAGATACCTGGACTAATGATGTTAGAAATACTACTGCTAGCAACACCAACAGCTA
ATCTAACTTCAGATAATTACATGATTGTGTTAGACAAGAAAATAATCAAAAAGACCAAGT
CATTCTTAGTCCTCTTCCTCACTAATATTTAAATGGAGCCGTTCTTCCTAAAAGCTGGGA
CTGGAGAAATATTTCTGGAGTTAACTATCTCTCAGTCACTCGTAACTAGCACATTCCTTA
ATACTGCGGTTCTTGTAATTAATTAATTAATTTTTTATTAAACACCTTTATTTTATTTTT
TAATATCTTCAAAGATATTGAAATTGAAAAGATATTTATTTATTTAATTTTGAGCTTAAT
TCTCTGAAAGATAGCATTTTATTACATACTATTAAATATTCATCAGACGATAGTAATATC
TTCAAACAAATTTTCTTAATTTATACTTAAGAGAAAACAAAATATTTTTTTATTTTTCAT
TAATTTAAAACACATAAATTATATTTTATAAATATTTTTTGTTATACTTCTTCAATATTA
GGTTTTAATATAACAACTAATAAATTTAGTTAGATTTTTTTCAAAATAAATTTTAATGAT
TATTTATAAATACAGGCTGGGCTCACGGTACCACATCTTCTATTGCTGATAGAATCAATA
TTGCTAGAAACAGAACTTTCCCTGATATTGAATTATCAGTTCAAGCCATTATTAATTGTA
AAGCTGGTGGTTCTTGCAATGGTGGTTAACCCATTTCTGTTTACTCATTTGCACATAAGA
AGGGTGTTCCTGAAGAATCTTGCCAAAACTATGTTGCTAAGAATCCTTAAAAGTTCTCTT
GTTCTGGTAATTACAAAAAACATTTTATATGAATAATTTTAATTTGGATTTAAAAATTAG
ATATTTAAAGATGTATGGATTGCACCAAGCCTGCTCCTACTAATACTACAGTTAACCCTG
GTAGATGTTGGGCTGTTGATAACTACGAAAACTGGAAGGTTGGTGAATATGGCACAGTTT
CTGGAGCTGATAAGATGAAGGCTGAAATCTTTGCTAGAGGTCCAATTTCCTGCGGTATTG
CTGTCACTAATAAGTTCGAAGCTTACACTGGTGGTGTTTACTCTGAAAAGAGCCTTACTC
GTATCAATCACGAAATTGCTGTTGTTGGTTGGGGTGTTGATGAAACCACTAACACTGAGT
ATTGGATTGGTAGAAATTCTTGGGGTACTTACTGGGGTGAAGATGGTTTCTTCAGAATTA
AAATGCACTCAGAAAATCTTAAAATTGAAACTGACTGCTCTTGGGGTGTTCCAGTTGTAG
AAAAATGA