Identifiers and Description

Gene Model Identifier

TTHERM_00564440

Standard Name

CTH35 (cathepsin 35)

Aliases

PreTt08982 | 75.m00180 | 3721.m00062

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07722 ) Peptidase C26
  • ( PF00112 ) Papain family cysteine protease
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 37.2%

TetraMine Data

TTHERM_00564440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14597.19.997093137033517e-262papain family cysteine proteas
e containing protein (949 aa)
OxytrichaContig19133.0.g744.0014960278073076e-143Papain family cysteine proteas
e
DictyBaseDDB_G02834011.9994274381022833e-63ctsZ on chromosome: 4 position
613897 to 615290
Stentor CoeruleusSteCoe_279402.3455513385429143e-59
WormBaseWBGene000007881.0002546821282671e-50locus:cpz-1 status:Confirmed
UniProt:G5EGP8 protein_id
:CCD70407.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00564440(coding)
ATGAAGTCAAGATTAAAATTAGAAATACTTGCAATTGTTTTTGCTCTAAGTATTTATGGC
ATCGCAGGTAAAACAAATCATATTAGCAAAGATTTTAAATAATCAGAACTTCCTACTCAA
TTTTCTTGGGCAAGTGTAAATGGAGTTAACTATTTGAGTTACGTAAGAAACTAATTAGCT
CCTAGATTATGTGATTCTGGATGGGCTTTTTCTGTTACTTCTTCACTAAATGATAGAATA
AAAATTAAAAGGCAAAATGCTGGGCCTGATTTTATTCTTTCTCCTTAAGTTTTAATTTCT
TGCAATGATGACAGTAATGGATGTCGTGGAGGATCTCCATAAACAGCATACGAATATATT
TTGAGAAACAACATTACTGATGAAACATGCTCTCCTTATACTGGTAGAGATTTTAGAGAT
GGCTATTAATGCAGCTCACTAACTGTTTGTATGGAATGCTGGCCAAAAGTAGGGTGCAAA
GCTAGAGATGATGCTTACATTTATTCAATTGAAAGTTGGGATTAAGTTAAAGGTGAAGAA
GATATGTAATAAGAAATATTTAATCATGGTCCCATTTCTTGCGTAATTAACTCTACAGAA
GATTTTAGAAACTACACTGGTGGAATACTAAATCCTCCAGATTCTCCTGTTTAAATTACA
CATTCTTTAAGCATTGTTGGTTGGGGTGAAGATGAGAAGTAAACTAAATATTGGATTGCT
AGAAACTCTTTAGGCACATTTTGGGGAGAAAATGGATTCATCAGAATTATTAGAGGTAAA
AATGCTCTTAAAATTGAAAGTGATTGCTCCTATGGTAGAATTAGAGATACATGGAGCTAA
TAAATAAGAAATAACACCTCGTTTAGCAAGAGCAATTCTAGTTATACTTCAAATAATTAA
TAGGAACACAAAATTAATTTAGATATCAATTCTAAATCTGAAAAAAATATTATTTAGTAA
GCTAAAGATGAGTTAAAGCAAATCTTTTAAGAGTCATATCAGAAATATCAACCTTTAATT
GAATCTATTTCTAGTAGCTTTAGTAATAACATAGAATTAGATGTGAGTACCCTTCCTACC
AATTTTACTTGGGGTAATGTAAACGGAGTTAATTACTTAACTTAAATAAAAAACCAACAT
AATCCATAGTATTGTGGGGGATGCTGGTCTTTTGCTGTTACAAGCAGCTTGTAGGATAGA
ATAAAAATTGCACGCAATAGAACAGATATTCCTGATGTAATTCTTTCAAATCAGATGATT
ATAAATTGCCATTTAGGTGGTTCCTGCTTTACTGGAGGAGTTTCATTGATAACCTACTAT
TTCCTTTCATAAATTGGAGTTGTTGAAGATTCTTGTATGCCTTACTAAGCGAAAGATTAA
TGGCTTCCTGTTTGCAATACCAAATAATAATGTATTTCATGTGAGCTTCCTTCTGCTCCT
ATCAGTAACACAACTGATATATCTTCTATCTGTCCAGCTCAAACAAAGTATCCTTACAAG
AAATGGAAAGTAAGTAAGTTTGGACACATTACAGGTGTAAAGTAAATGAAAAGCGAAATA
TATTCTAGAGGACCTATTTCTTGTACCATTGATGCCACTGATAATTTAGAAAATAATTAC
ACAGGTGGTATTTACAGTGAAAAAGTTAAGTTACCTATACCCAATCACTATGTGTCTGTA
GTTGGATGGGGTTAGACTTTAGAAGGTGAGGAATACTGGATAGTTAGAAATTCTTGGGGA
ACCTATTGGGGAGAGGAAGGATTTTTTAAGTTAAAAATGCACAAAGACAATTTGGGTTTA
GAATTTGGTTGCTCTTGGGGAGTTATAGATCTTTAATAATGA


>TTHERM_00564440(protein)
MKSRLKLEILAIVFALSIYGIAGKTNHISKDFKQSELPTQFSWASVNGVNYLSYVRNQLA
PRLCDSGWAFSVTSSLNDRIKIKRQNAGPDFILSPQVLISCNDDSNGCRGGSPQTAYEYI
LRNNITDETCSPYTGRDFRDGYQCSSLTVCMECWPKVGCKARDDAYIYSIESWDQVKGEE
DMQQEIFNHGPISCVINSTEDFRNYTGGILNPPDSPVQITHSLSIVGWGEDEKQTKYWIA
RNSLGTFWGENGFIRIIRGKNALKIESDCSYGRIRDTWSQQIRNNTSFSKSNSSYTSNNQ
QEHKINLDINSKSEKNIIQQAKDELKQIFQESYQKYQPLIESISSSFSNNIELDVSTLPT
NFTWGNVNGVNYLTQIKNQHNPQYCGGCWSFAVTSSLQDRIKIARNRTDIPDVILSNQMI
INCHLGGSCFTGGVSLITYYFLSQIGVVEDSCMPYQAKDQWLPVCNTKQQCISCELPSAP
ISNTTDISSICPAQTKYPYKKWKVSKFGHITGVKQMKSEIYSRGPISCTIDATDNLENNY
TGGIYSEKVKLPIPNHYVSVVGWGQTLEGEEYWIVRNSWGTYWGEEGFFKLKMHKDNLGL
EFGCSWGVIDLQQ


>TTHERM_00564440(gene)
ATGAAGTCAAGATTAAAATTAGAAATACTTGCAATTGTTTTTGCTCTAAGTATTTATGGC
ATCGCAGGTAAAACAAATCATATTAGCAAAGATTTTAAATAATCAGAACTTCCTACTCAA
TTTTCTTGGGCAAGTGTAAATGGAGTTAACTATTTGAGTTACGTAAGAAACTAATTAGCT
CCTAGATTATGTGATTCTGGATGGGCTTTTTCTGTTACTTCTTCACTAAATGATAGAATA
AAAATTAAAAGGCAAAATGCTGGGCCTGATTTTATTCTTTCTCCTTAAGTTTTAATTTCT
TGCAATGATGACAGTAATGGATGTCGTGGAGGATCTCCATAAACAGCATACGAATATATT
TTGAGAAACAACATTACTGATGAAACATGCTCTCCTTATACTGGTAGAGATTTTAGAGAT
GGCTATTAATGCAGGTAACACAATTATAATATAATTTAATAATGAATGATTTTAAAAATT
AACTTAACTCAAAAATTTTAAAGGTTCAATTTTTAAATTTTAACCTATTTTTTACATAAA
TTAGCTCACTAACTGTTTGTATGGAATGCTGGCCAAAAGTAGGGTGCAAAGCTAGAGATG
ATGCTTACATTTATTCAATTGAAAGTTGGGATTAAGTTAAAGGTGAAGAAGATATGTAAT
AAGAAATATTTAATCATGGTCCCATTTCTTGCGTAATTAACTCTACAGAAGATTTTAGAA
ACTACACTGGTGGAATACTAAATCCTCCAGATTCTCCTGTTTAAATTACACATTCTTTAA
GCATTGTTGGTTGGGGTGAAGATGAGAAGTAAACTAAATATTGGATTGCTAGAAACTCTT
TAGGCACATTTTGGGGAGAAAATGGATTCATCAGAATTATTAGAGGTAAAAATGCTCTTA
AAATTGAAAGTGATTGCTCCTATGGTAGAATTAGAGATACATGGAGCTAATAAATAAGAA
ATAACACCTCGTTTAGCAAGAGCAATTCTAGTTATACTTCAAATAATTAATAGGAACACA
AAATTAATTTAGATATCAATTCTAAATCTGAAAAAAATATTATTTAGTAAGCTAAAGATG
AGTTAAAGCAAATCTTTTAAGAGTCATATCAGAAATATCAACCTTTAATTGAATCTATTT
CTAGTAGCTTTAGTAATAACATAGAATTAGATGTGAGTACCCTTCCTACCAATTTTACTT
GGGGTAATGTAAACGGAGTTAATTACTTAACTTAAATAAAAAACCAACATAATCCATAGT
ATTGTGGGGGATGCTGGTCTTTTGCTGTTACAAGCAGCTTGTAGGATAGAATAAAAATTG
CACGCAATAGAACAGATATTCCTGATGTAATTCTTTCAAATCAGATGATTATAAATTGCC
ATTTAGGTGGTTCCTGCTTTACTGGAGGAGTTTCATTGATAACCTACTATTTCCTTTCAT
AAATTGGAGTTGTTGAAGATTCTTGTATGCCTTACTAAGCGAAAGATTAATGGCTTCCTG
TTTGCAATACCAAATAATAATGTATTTCATGTGAGCTTCCTTCTGCTCCTATCAGTAACA
CAACTGATATATCTTCTATCTGTCCAGCTCAAACAAAGTATCCTTACAAGAAATGGAAAG
TAAGTAAGTTTGGACACATTACAGGTGTAAAGTAAATGAAAAGCGAAATATATTCTAGAG
GACCTATTTCTTGTACCATTGATGCCACTGATAATTTAGAAAATAATTACACAGGTGGTA
TTTACAGTGAAAAAGTTAAGTTACCTATACCCAATCACTATGTGTCTGTAGTTGGATGGG
GTTAGACTTTAGAAGGTGAGGAATACTGGATAGTTAGAAATTCTTGGGGAACCTATTGGG
GAGAGGAAGGATTTTTTAAGTTAAAAATGCACAAAGACAATTTGGGTTTAGAATTTGGTT
GCTCTTGGGGAGTTATAGATCTTTAATAATGA