Identifiers and Description

Gene Model Identifier

TTHERM_00079660

Standard Name

CTH33 (cathepsin 33)

Aliases

PreTt10211 | 5.m00562 | 3828.m01474

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08127 ) Peptidase family C1 propeptide
  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00079660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06986.19.997093137033517e-262papain family cysteine proteas
e containing protein (340 aa)
WormBaseWBGene000007864.0008598455422075e-100locus:cpr-6 Cathepsin B-like
cysteine proteinase 6 statu
s:Confirmed UniProt:P43510
protein_id:CCD65628.1
DictyBaseDDB_G02839213.000235161122315e-61ctsB on chromosome: 4 position
1297288 to 1298315
OxytrichaContig604.1.g923.0011931572567413e-53Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_88355.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079660(coding)
ATGAGAAAATCAATTCTTTCAATTTTGATTTTAGGCTGCTTGTTTTCAACTTCAGCAAAC
TGCTTCAAATTCGGAGAAATGTCTCCCTTTATTGTATTTGAAGTCAACTCAAATCCTAAC
TCTACTTGGAAAGCTGCTCGTTATCCTCACTTCGAAAAAATGACTCGTGAATAACTCCTT
GGTCATCTTGGTTCACTTGATGAACCTGATTGGGTTAAACTCCCTACTAAAGAATTTGAT
CCTAACGCAAATGCAGATCCTATCCCTGAATTCTTCGATGCTCGTGAATAATGGCCTAAC
TGTTAAAGCATTAAGCTTATTAGAGATTAATCTACTTGCGGTTCATGCTGGGCTTTTGCT
GCAACTGAAACTTTCTCTGATAGAATTTGTATTGCAAGTAATTAAACTTTATAAACTTCA
ATTTCCTCTGAAGATTTATTGGAATGCTGTGCTGATTATTGTGGTATGGGTTGTAAAGGT
GGTTATCCTAGCGCTGCTTGGGGCTACATGAAAAGATAAGGTGTCTCAACTGGTGGTCTT
TATGGAGATGATACTTCCTGCAAACCCTACATTTTCCCTCCTTGTGATCACCATGTCACT
GGGTAATACCAACCTTGCGGTCCTATCTAACCTACTCCTTAATGTGTTAAAGAATGCAAC
TCTGAATATACCTAAAATACTTATGAAAAGGATCTTCACTTTGCTTCTTAAACTTATTCC
ATTAAACAAAACGTTTAAGCCATTCAAAGAGAAATAATGGCCCATGGTCCTGTCTAAGCT
TCCTTCAAGGTTGCTGCTGATTTCCTTACTTATAAGAGTGGTGTATACATTAGAAATCCC
AAGTTGAAATATGAAGGCGGTCACTCAGTTAAGATTATTGGTTGGGGTAAGGAAGGCAAT
ACTCCATACTGGCTTATTGCTAACTCCTGGAATGAAGATTGGGGTGAGAAGGGATTATTC
AGAATGTTAAGAGGAAGAAATGAATGTGGTATCGAAGCTCAAATTGTTGCTGGTCTTCCT
TGA


>TTHERM_00079660(protein)
MRKSILSILILGCLFSTSANCFKFGEMSPFIVFEVNSNPNSTWKAARYPHFEKMTREQLL
GHLGSLDEPDWVKLPTKEFDPNANADPIPEFFDAREQWPNCQSIKLIRDQSTCGSCWAFA
ATETFSDRICIASNQTLQTSISSEDLLECCADYCGMGCKGGYPSAAWGYMKRQGVSTGGL
YGDDTSCKPYIFPPCDHHVTGQYQPCGPIQPTPQCVKECNSEYTQNTYEKDLHFASQTYS
IKQNVQAIQREIMAHGPVQASFKVAADFLTYKSGVYIRNPKLKYEGGHSVKIIGWGKEGN
TPYWLIANSWNEDWGEKGLFRMLRGRNECGIEAQIVAGLP


>TTHERM_00079660(gene)
ATGAGAAAATCAATTCTTTCAATTTTGATTTTAGGCTGCTTGTTTTCAACTTCAGCAAAC
TGCTTCAAATTCGGAGAAATGTCTCCCTTTATTGTATTTGAAGTCAACTCAAATCCTAAC
TCTACTTGGAAAGCTGCTCGTTATCCTCACTTCGAAAAAATGACTCGTGAATAACTCCTT
GGTCATCTTGGTTCACTTGATGAACCTGATTGGGTTAAACTCCCTACTAAAGAATTTGAT
CCTAACGCAAATGCAGATCCTATCCCTGAATTCTTCGATGCTCGTGAATAATGGCCTAAC
TGTTAAAGCATTAAGCTTATTAGAGATTAATCTACTTGCGGTTCATGCTGGGCTTTTGCT
GCAACTGAAACTTTCTCTGATAGAATTTGTATTGCAAGTAATTAAACTTTATAAACTTCA
ATTTCCTCTGAAGATTTATTGGAATGCTGTGCTGATTATTGTGGTATGGGTTGTAAAGGT
GGTTATCCTAGCGCTGCTTGGGGCTACATGAAAAGATAAGGTGTCTCAACTGGTGGTCTT
TATGGAGATGATACTTCCTGCAAACCCTACATTTTCCCTCCTTGTGATCACCATGTCACT
GGGTAATACCAACCTTGCGGTCCTATCTAACCTACTCCTTAATGTGTTAAAGAATGCAAC
TCTGAATATACCTAAAATACTTATGAAAAGGATCTTCACTTTGTAATTAAAAATATCAAA
AATATTTAATAATTTAATTAAAAAATTATATTTCTATTTCAAATTAATTAATAACCCTTA
TTTTATATTTTAGGCTTCTTAAACTTATTCCATTAAACAAAACGTTTAAGCCATTCAAAG
AGAAATAATGGCCCATGGTCCTGTCTAAGCTTCCTTCAAGGTTGCTGCTGATTTCCTTAC
TTATAAGAGTGGTGTATACATTAGAAATCCCAAGTTGAAATATGAAGGCGGTCACTCAGT
TAAGATTATTGGTTGGGGTAAGGAAGGCAATACTCCATACTGGCTTATTGCTAACTCCTG
GAATGAAGATTGGGGTGAGAAGGGATTATTCAGAATGTTAAGAGGAAGAAATGAATGTGG
TATCGAAGCTCAAATTGTTGCTGGTCTTCCTTGA