Identifiers and Description

Gene Model Identifier

TTHERM_01248970

Standard Name

CTH32 (CaTHepsin 32)

Aliases

PreTt04492 | 291.m00033

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01290 ) Thymosin beta-4 family
  • ( TIGR00193 ) urease, gamma subunit
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 84.7%

TetraMine Data

TTHERM_01248970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10152.19.997093137033517e-262papain family cysteine proteas
e containing protein (343 aa)
DictyBaseDDB_G02909571.000371485572848e-69cprA on chromosome: 5 position
4812963 to 4814596
WormBaseWBGene000070558.996056580502358e-68locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
OxytrichaContig19120.0.g784.000223764421475e-57Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_24164.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01248970(coding)
ATGAATATGAAATTCATAGTTTATATTTTTGTCTTAGTTGCTGTTGCTTCATGCGCTTAC
ATGAATGAAACTATAGATCCTTAACGCTTGGCTGAGTTTGAGGAATTCAAGTCCAAATTC
AATAAATATTATCACAATGAACATGAACATCATTCCAGTTTCCACAACTATAAAACTAGT
AGAGAACATATTGTCAAGCACCAAATGGAAAATCCAAACGCTAAATTTGGCCACACTAAG
TTCTCTGACATGAGTCCTGAAGAATTCGAGAACAAGATGCTCAATTTCGACTTTTCTCTT
TTTAAGAAAGCCAAATCACAAGGAATTAAATTAAAAGCTGAGCCTATGAAGGGTTATTTA
AGATAAGGTGAAAACGTTGATAATAGCGATTTACCCGAATCATTTGATTGGAGAGATAAA
GGCATTATCACTCCCGCTAAATTTTAAAACACTTGCGGTAGCTGTTGGACCTTTGCCACA
ACCGGAGTCATTGAATCTCAATATGCTCTTAAATACGGCGAACTTCTCCATTTCTCTGAA
TAAATGCTTTTGGATTGTGACAACATTAATTAAGGTTGTAGAGGTGGTTTGATGACCGAT
GCTTATCAATTCCTTTAATAAAGTGGTGGTATCTAAACAGCTGACACTTATGGTGATTAC
AAAAATAAGAAGGACATTTGCAACTTTGATAAGGCCAAAGTTAAAGCTAAAGTTGTTGAT
TGGTACTAGATTCCTGAGAATGAAGAAACTATCAGAAGAGAACTCGTTAAGAACGGTCCT
GTTGCCGTTGGTATTAATGCCAGAACTTTGTAATTCTACGAAGGAGGTATCGTTGATCCC
AAGAACTGTGATGACAAAATTAATCATGCCGTCCTTATTGTTGGTTACGGTGTTGAAGAA
GGCATTCCTTATTGGTTAATTAAAAATCAATGGGGTGCTGAATGGGGTATTAAGGGTTTC
TTCAAATTAATCAGAGGAAAAAAACAATGTGGTATCCACACATATGCCTCTATTGCTTAT
GTAGAAAAAGTCTGA


>TTHERM_01248970(protein)
MNMKFIVYIFVLVAVASCAYMNETIDPQRLAEFEEFKSKFNKYYHNEHEHHSSFHNYKTS
REHIVKHQMENPNAKFGHTKFSDMSPEEFENKMLNFDFSLFKKAKSQGIKLKAEPMKGYL
RQGENVDNSDLPESFDWRDKGIITPAKFQNTCGSCWTFATTGVIESQYALKYGELLHFSE
QMLLDCDNINQGCRGGLMTDAYQFLQQSGGIQTADTYGDYKNKKDICNFDKAKVKAKVVD
WYQIPENEETIRRELVKNGPVAVGINARTLQFYEGGIVDPKNCDDKINHAVLIVGYGVEE
GIPYWLIKNQWGAEWGIKGFFKLIRGKKQCGIHTYASIAYVEKV


>TTHERM_01248970(gene)
ATGAATATGAAATTCATAGTTTATATTTTTGTCTTAGTTGCTGTTGCTTCATGCGCTTAC
ATGAATGAAACTATAGATCCTTAACGCTTGGCTGAGTTTGAGGAATTCAAGTCCAAATTC
AATAAATATTATCACAATGAACATGAACATCATTCCAGTTTCCACAACTATAAAACTAGT
AGAGAACATATTGTCAAGCACCAAATGGAAAATCCAAACGCTAAATTTGGCCACACTAAG
TTCTCTGACATGAGTCCTGAAGAATTCGAGAACAAGATGCTCAATTTCGACTTTTCTCTT
TTTAAGAAAGCCAAATCACAAGGAATTAAATTAAAAGCTGAGCCTATGAAGGGTTATTTA
AGATAAGGTGAAAACGTTGATAATAGCGATTTACCCGAATCATTTGATTGGAGAGATAAA
GGCATTATCACTCCCGCTAAATTTTAAAACACTTGCGGTAGCTGTTGGACCTTTGCCACA
ACCGGAGTCATTGAATCTCAATATGCTCTTAAATACGGCGAACTTCTCCATTTCTCTGAA
TAAATGCTTTTGGATTGTGACAACATTAATTAAGGTTGTAGAGGTGGTTTGATGACCGAT
GCTTATCAATTCCTTTAATAAAGTGGTGGTATCTAAACAGTAAATTAAATATTCTTTATT
TAAAATCAATAATTAAATGATTTTTCAATTTTTATCTTAGAAAAAAATAAATAATTCATT
ATTTTTAAAATTAATAATTAAATAAATTGAATAGGCTGACACTTATGGTGATTACAAAAA
TAAGAAGGACATTTGCAACTTTGATAAGGCCAAAGTTAAAGCTAAAGTTGTTGATTGGTA
CTAGATTCCTGAGGTGATTTTTTATTTTCTAATTAATTAATATATTTTTGTAGCTTAAGC
AAAAAGTTCAAAATTCAATTTTTGGATTTATTTGATTATTTATTCAAAATTAATTTATTT
TCTAATAATTTAGAATGAAGAAACTATCAGAAGAGAACTCGTTAAGAACGGTCCTGTTGC
CGTTGGTATTAATGCCAGAACTTTGTAATTCTACGAAGGAGGTATCGTTGATCCCAAGAA
CTGTGATGACAAAATTAATCATGCCGTCCTTATTGTTGGTTACGGTGTTGAAGAAGGCAT
TCCTTATTGGTTAATTAAAAATCAATGGGGTGCTGAATGGGGTATTAAGGGTTTCTTCAA
ATTAATCAGAGGAAAAAAACAATGTGGTATCCACACATATGCCTCTATTGCTTATGTAGA
AAAAGTCTGA