Identifiers and Description

Gene Model Identifier

TTHERM_00502690

Standard Name

CTH30 (cathepsin 30)

Aliases

PreTt08108 | 63.m00286 | 3716.m00138

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 85.8%

TetraMine Data

TTHERM_00502690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21134.19.997093137033517e-262papain family cysteine proteas
e containing protein (618 aa)
OxytrichaContig18805.0.g129.995951036711152e-55Papain family cysteine proteas
e
Stentor CoeruleusSteCoe_284101.2995814250075031e-24
WormBaseWBGene000007825.998186291993296e-23locus:cpr-2 status:Partially
_confirmed UniProt:O45466
protein_id:CAB04322.3
DictyBaseDDB_G02924623.999970367130025e-21DDB_G0292462 on chromosome: 6
position 1678244 to 1679313

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00502690(coding)
ATGAAGAATGTAGATTTTTTGAAATGGAAAAATTCTTTGTTATTTTTTATGCTTTTAATG
ATTTATGTTACTTAAATATAATGTGATTTACCTATTCAATGCGTAAAGCATTAAATTGTT
GGATAATGGACAATACAAACTTCTAAAGTACATTCTAAATATAATTAATTTCTTACTTGT
GGTCATTCAATTCCTGATTCACCTGATCAATCTATATAGTCAGATTAAAATAATTTCAAA
CATACAAAAGAATATTTAGTTGATTTGCATGAAAATGGAGAGGCATTTTTACTAAAAAAT
TCTTCTTAGATCAAAGGTTAATGGACGATGATGTATGATGAAGGTTTTTAAATTGATGTT
GATGAAATGAGCTTTTTTACATTTTTTAAGTATTATCCTATAAAAGAAGAATAAATTTCA
GAAAGAGTGCTTGTAGAAGATATAACTGTAGTCAGTCATTCTAAAGTGACTACTTATGAA
TTCGACTGTACTGAAACAATTGTTGGTTGGTTCAATGTGCCAACAAAAAATAAAAAAGGA
TGCATGAAAGCTTATAAAGTTAATCCTAGGGAAGAGGATAGGCATCTTAGAAGCTAACAG
AAAGGAAGTGTAGTATAGCCTTTAGATTTCGATATAAATAACTTCACAATCCAAGATGAT
ATTGATTAAATTAATTCTTCTTAGTAAGATGGACTTTTATACGATTAGTAAAGTTCATCT
AGTATAAAAAAAAGAAAATTCAATTTGCAAGGCACATTAAATAGTATTATTGAAAACATA
GGGCCAGAAGATAGCAGCCCTTAGAGTGAATAGTTAGAGTTAGATTAAAAATAAAGTACA
TAAAAAAGCAATAATATAAATTAAAAGTAAAATGCTGAGTTAAATTAAAATGTTCATAAA
AATAGGATAGATTAGCTTAATTCCTTAAATAAAAATTGGCAGGCTGGTATTTCTTCATCA
TTTTAAGATTTGACCTTAGATGAAGTAAATAAAAAAGCTGGTAGAAACAAAAGAAAGCAA
CAAAAAAAAAATTCTAAAAAAAAAGTAATTAATGAATCTGAAATGTCTAAATTAAATGAG
GAGCAATCACTTTATATGCATTTTTCAATATAAGATGTTAGTGACCTACCAAAAAATTTT
TCTTGGGAGGAATATATAGATAATCCAATAGAGCAAAATGATTGTGGTTCGTGCTATATA
ATCTCTACAGTATAGATGCTTAATGCTAGGTTAAAGATTAAATATGGTAAGGACTTTACC
AAAAAGATTTCAATGCAACACCTATTAGATTGCTCTTTTTATTCTTAGGGATGTGATGGA
GGATATCCATTTGAGCTAGGAAGATTTGGCAAAGATTATTTTATGCTACCTGATAACAAT
ACTAAATTTTAAAACGAAGTAAAAGAATGCTAGATTAAAAATTTAGAAAAATTAGACGAG
TATTTCAAAGTTACTGATTATGGATTTGTAGGATAATAGTATGGTAAAGGAAATGAAAGA
GAAATGATGTTAGAGATAATGAAGAATGGACCTATTGTTGCCAACTTTAAAACTAGTGCA
GATTTTGTTTACTACAAAAGTGGGGTTTATCATTCAGTAGAAGCTGCAGACTGGATTCTC
AAGTGTGAGGTTGAGCCTGAGTGGAGACCTGTTGAGCATGCTGTTATGTGCTATGGCTGG
GGCGAATCAGAAGAAGATGGAAAATTTTGGCTAATGTAAAATTCATGGGGTGATGATTGG
GGAGAAAAAGGTCGATTTAAGATAAGAAGGGGGACAGATGAATCGTTTGTAGAATCAAGT
GCTGAATATGCTTAAGTAGAATATATTAATAATAAACAATGA


>TTHERM_00502690(protein)
MKNVDFLKWKNSLLFFMLLMIYVTQIQCDLPIQCVKHQIVGQWTIQTSKVHSKYNQFLTC
GHSIPDSPDQSIQSDQNNFKHTKEYLVDLHENGEAFLLKNSSQIKGQWTMMYDEGFQIDV
DEMSFFTFFKYYPIKEEQISERVLVEDITVVSHSKVTTYEFDCTETIVGWFNVPTKNKKG
CMKAYKVNPREEDRHLRSQQKGSVVQPLDFDINNFTIQDDIDQINSSQQDGLLYDQQSSS
SIKKRKFNLQGTLNSIIENIGPEDSSPQSEQLELDQKQSTQKSNNINQKQNAELNQNVHK
NRIDQLNSLNKNWQAGISSSFQDLTLDEVNKKAGRNKRKQQKKNSKKKVINESEMSKLNE
EQSLYMHFSIQDVSDLPKNFSWEEYIDNPIEQNDCGSCYIISTVQMLNARLKIKYGKDFT
KKISMQHLLDCSFYSQGCDGGYPFELGRFGKDYFMLPDNNTKFQNEVKECQIKNLEKLDE
YFKVTDYGFVGQQYGKGNEREMMLEIMKNGPIVANFKTSADFVYYKSGVYHSVEAADWIL
KCEVEPEWRPVEHAVMCYGWGESEEDGKFWLMQNSWGDDWGEKGRFKIRRGTDESFVESS
AEYAQVEYINNKQ


>TTHERM_00502690(gene)
ATGAAGAATGTAGATTTTTTGAAATGGAAAAATTCTTTGTTATTTTTTATGCTTTTAATG
ATTTATGTTACTTAAATATAATGTGATTTACCTATTCAATGCGTAAAGCATTAAATTGTT
GGATAATGGACAATACAAACTTCTAAAGTACATTCTAAATATAATTAATTTCTTACTTGT
GGTCATTCAATTCCTGATTCACCTGATCAATCTATATAGTCAGATTAAAATAATTTCAAA
GTAATTCATTCATTTAGTAAGAAAAAAATACAAAATTATAATTATTATGGTAATATTTTA
GCATACAAAAGAATATTTAGTTGATTTGCATGAAAATGGAGAGGCATTTTTACTAAAAAA
TTCTTCTTAGATCAAAGTATATTATTAGTTAATTAGTTAGTATTTTATATTCTATTTTTC
AGATAAATTAAATGATTTGAATCATTTGAAATTTATAAATGTGAATCTATTTAATTGTTT
AAAAAGGGTTAATGGACGATGATGTATGATGAAGGTTTTTAAATTGATGTTGATGAAATG
AGCTTTTTTACATTTTTTAAGTATTATCCTATAAAAGAAGAATAAATTTCAGAAAGAGTG
CTTGTAGAAGATATAACTGTAGTCAGTCATTCTAAAGTGACTACTTATGAATTCGACTGT
ACTGAAACAATTGTTGGTTGGTTCAATGTGCCAACAAAAAATAAAAAAGGATGCATGAAA
GCTTATAAAGTTAATCCTAGGGAAGAGGATAGGCATCTTAGAAGCTAACAGAAAGGAAGT
GTAGTATAGCCTTTAGATTTCGATATAAATAACTTCACAATCCAAGATGATATTGATTAA
ATTAATTCTTCTTAGTAAGATGGACTTTTATACGATTAGTAAAGTTCATCTAGTATAAAA
AAAAGAAAATTCAATTTGCAAGGCACATTAAATAGTATTATTGAAAACATAGGGCCAGAA
GATAGCAGCCCTTAGAGTGAATAGTTAGAGTTAGATTAAAAATAAAGTACATAAAAAAGC
AATAATATAAATTAAAAGTAAAATGCTGAGTTAAATTAAAATGTTCATAAAAATAGGATA
GATTAGCTTAATTCCTTAAATAAAAATTGGCAGGCTGGTATTTCTTCATCATTTTAAGAT
TTGACCTTAGATGAAGTAAATAAAAAAGCTGGTAGAAACAAAAGAAAGCAACAAAAAAAA
AATTCTAAAAAAAAAGTAATTAATGAATCTGAAATGTCTAAATTAAATGAGGAGCAATCA
CTTTATATGCATTTTTCAATATAAGATGTTAGTGACCTACCAAAAAATTTTTCTTGGGAG
GAATATATAGATAATCCAATAGAGCAAAATGATTGTGGTTCGTGCTATATAATCTCTACA
GTATAGATGCTTAATGCTAGGTTAAAGATTAAATATGGTAAGGACTTTACCAAAAAGATT
TCAATGCAACACCTATTAGATTGCTCTTTTTATTCTTAGGTATTAAATATATTTACTATT
TCTCCTTATAATAATCAATTTTATTTACAAATATATATATATATATATTTAAGGGATGTG
ATGGAGGATATCCATTTGAGCTAGGAAGATTTGGCAAAGATTATTTTATGCTACCTGATA
ACAATACTAAATTTTAAGTAAGAATTTAATAGTATTTTATTTAATTTACCTATTAAATCT
GAATTAAAATAGAACGAAGTAAAAGAATGCTAGATTAAAAATTTAGAAAAATTAGACGAG
TATTTCAAAGTTACTGATTATGGGTAATTATATATATTTATATTTTTATAGTTTAATAAT
ATTGATGACTAAAGATTTGTAGGATAATAGTATGGTAAAGGAAATGAAAGAGAAATGATG
TTAGAGATAATGAAGAATGGACCTATTGTTGCCAACTTTAAAACTAGTGCAGATTTTGTT
TACTACAAAAGTGGGGTTTATCATTCAGTAGAAGCTGCAGACTGGATTCTCAAGTGTATT
ATTTAAAAAATAATCAACAATCACATTATCTTAAATATTTTTTTGTTTAGGTGAGGTTGA
GCCTGAGTGGAGACCTGTTGAGCATGCTGTTATGTGGTATACTTTTCTTTTAAATAAGCT
TTCTCTTTTATTTCTATCAATCTTTCATAATCGTTATAGTTAACACTAACAATAATTTTT
AAATAGCTATGGCTGGGGCGAATCAGAAGAAGATGGAAAATTTTGGCTAATGTAAAATTC
ATGGGGTGATGATTGGGGAGAAAAAGGTCGATTTAAGTAACTATTACTAAATTTTTATTT
AAAAACTTAAAAAATTAATTCATAATTTAAGGATAAGAAGGGGGACAGATGAATCGTTTG
TAGAATCAAGTGCTGAATATGCTTAAGTAGAATATATTAATAATAAACAATGA