Identifiers and Description

Gene Model Identifier

TTHERM_00437390

Standard Name

CTH29 (cathepsin 29)

Aliases

PreTt05395 | 49.m00167 | 3708.m00017

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 24.3%

TetraMine Data

TTHERM_00437390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12489.11.999382702437002e-145hypothetical protein (461 aa)
OxytrichaContig12182.0.g256.001696815660978e-24Eukaryotic aspartyl protease
WormBaseWBGene000002183.0007793728221555e-22locus:asp-5 status:Confirmed
UniProt:O01532 protein_id
:CCD64747.1
SGDYPL154C2.9990241513684e-21PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
DictyBaseDDB_G02794110.0000000000000299873730555305ctsD on chromosome: 3 position
2104523 to 2105867

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00437390(coding)
ATGTATGCCATCTTTGTTTTTATTGTAAGCCATCCTAATCTTATATCAGGTATGGCCAAA
TACTTATTTTATAATCATTAAATTTCGTTTTATAGATTTAAAAATAGACTATCTAAAAAG
TTAATATTAAATCAAGATAACAAGATTATGAATATCAGCTATTCAAAGCTCATTTTTTTG
TTTTTATTTGTATGCCTTTTACAAAGCAAACAAATAGAAATCTAAAGAAAGTAAACTGGT
AACTCTGTGTATAATGAAGCATACAATTAATCATAGATAAATACAGATTTTTCTTCAGGT
TCGTTAGAATAATCCTATAATTTTATCACATAAGAATTAAATAATATTGATGATTACTAA
TATGTTGTTTAGATTTATATAGGGTAATCAAAGGAGCCTTTTAATTTTTTATTAGATACA
GGAAGCAATATTCTTTGGATTCCTGGAACTGAGTGTAATCTGTAAGATAATCATTGCCAT
ACGAAAGATATCTATGATTACTCAAAAAGTCAGACAGCTATTGTAAATAAAGACAAAAAA
ATTGAAATATAATATGGATAAGGTAAATGCGAAGGTTACCTTGGCTCTGAATATATACGC
ATCTATTAAGAAAGCTAACCATTTAAAGCAGAAATTTTGTTTACTAGCAGTGACAAAGAT
ATGGATGGTATGTAATCACATGGTATCCTAGGGCTAAGCAACAGTAAATCAACAAAAAAC
TACTTAGAATATGCAGTAGAATAAGAAATTATATCCTCATCTGTATTTGCTCTTGAGTTA
AAAAATCTTCCTGATATATCTTATTTTTACTATGATAATATTCCTGAATATAAATTATCG
AATACTATATTTGTAAATACAGCTAGTAAAGAAAGGTGGTTAATAGATGTGATAGGGTTT
TATATGAATGACTCAGACTACACAGATTCAAGCAACTAAACAGTATTAATCGATTCAGGT
GCTTCCTTTATGCATTTAACAAAATCTTTATATGACAAATTTATACATAATTATGCAAGT
AATGTTTGTTTCTACCAATATGGGGAATATGTTTGTAGCTGCTAATAAGAAATTCTCAAC
TAAAACTTACCAATTATAAAATTTTATACTTAAGAAGGTATACTATAAATATCTCCTCAA
GACTATGTAATTAAAAAAGGCCAAAAATGCATACTTGCTATAGATTTCTAGGATACTTTT
GATTTTAACATTTTAGGTGACGTTTTGCTAAGAAAATATTTTGTTATTTTTGATAAATAA
AAGCAGCAAATGGGTTTTGGAAATGTTGAAAATAAAATTCAACATTTATAACCACTTAGT
ATGCTAATAGTATTTTCTATCTTCTCTGTTTTCACTTTTATGCTACTCTGCGCAGTAATT
TATAAAGTAATAATTCTTAAGAAAGGTTAATATTAATAAGAATAAGATTAAGAATAAATC
AATCAAACTCTTCTAGGTAATAACATTCAATTAAACTTGTAAGATTTGGAAAGGAGAAGT
AGTTATTCAGCTAGAAGTTCATCTTGA


>TTHERM_00437390(protein)
MYAIFVFIVSHPNLISGMAKYLFYNHQISFYRFKNRLSKKLILNQDNKIMNISYSKLIFL
FLFVCLLQSKQIEIQRKQTGNSVYNEAYNQSQINTDFSSGSLEQSYNFITQELNNIDDYQ
YVVQIYIGQSKEPFNFLLDTGSNILWIPGTECNLQDNHCHTKDIYDYSKSQTAIVNKDKK
IEIQYGQGKCEGYLGSEYIRIYQESQPFKAEILFTSSDKDMDGMQSHGILGLSNSKSTKN
YLEYAVEQEIISSSVFALELKNLPDISYFYYDNIPEYKLSNTIFVNTASKERWLIDVIGF
YMNDSDYTDSSNQTVLIDSGASFMHLTKSLYDKFIHNYASNVCFYQYGEYVCSCQQEILN
QNLPIIKFYTQEGILQISPQDYVIKKGQKCILAIDFQDTFDFNILGDVLLRKYFVIFDKQ
KQQMGFGNVENKIQHLQPLSMLIVFSIFSVFTFMLLCAVIYKVIILKKGQYQQEQDQEQI
NQTLLGNNIQLNLQDLERRSSYSARSSS


>TTHERM_00437390(gene)
ATGTATGCCATCTTTGTTTTTATTGTAAGCCATCCTAATCTTATATCAGGTATGGCCAAA
TACTTATTTTATAATCATTAAATTTCGTTTTATAGATTTAAAAATAGACTATCTAAAAAG
TTAATATTAAATCAAGATAACAAGATTATGAATATCAGCTATTCAAAGCTCATTTTTTTG
TTTTTATTTGTATGCCTTTTACAAAGCAAACAAATAGAAATCTAAAGAAAGTAAACTGGT
AACTCTGTGTATAATGAAGCATACAATTAATCATAGATAAATACAGATTTTTCTTCAGGT
TCGTTAGAATAATCCTATAATTTTATCACATAAGAATTAAATAATATTGATGATTACTAA
TATGTTGTTTAGATTTATATAGGGTAATCAAAGGAGCCTTTTAATTTTTTATTAGATACA
GGAAGCAATATTCTTTGGATTCCTGGAACTGAGTGTAATCTGTAAGATAATCATTGCCAT
ACGAAAGATATCTATGATTACTCAAAAAGTCAGACAGCTATTGTAAATAAAGACAAAAAA
ATTGAAATATAATATGGATAAGGTAAATGCGAAGGTTACCTTGGCTCTGAATATATACGC
ATCTATTAAGAAAGCTAACCATTTAAAGCAGAAATTTTGTTTACTAGCAGTGACAAAGAT
ATGGATGGTATGTAATCACATGGTATCCTAGGGCTAAGCAACAGTAAATCAACAAAAAAC
TACTTAGAATATGCAGTAGAATAAGAAATTATATCCTCATCTGTATTTGCTCTTGAGTTA
AAAAATCTTCCTGATATATCTTATTTTTACTATGATAATATTCCTGAATATAAATTATCG
AATACTATATTTGTAAATACAGCTAGTAAAGAAAGGTGGTTAATAGATGTGATAGGGTTT
TATATGAATGACTCAGACTACACAGATTCAAGCAACTAAACAGTATTAATCGATTCAGGT
GCTTCCTTTATGCATTTAACAAAATCTTTATATGACAAATTTATACATAATTATGCAAGT
AATGTTTGTTTCTACCAATATGGGGAATATGTTTGTAGCTGCTAATAAGAAATTCTCAAC
TAAAACTTACCAATTATAAAATTTTATACTTAAGAAGGTATACTATAAATATCTCCTCAA
GACTATGTAATTAAAAAAGGCCAAAAATGCATACTTGCTATAGATTTCTAGGATACTTTT
GATTTTAACATTTTAGGTGACGTTTTGCTAAGAAAATATTTTGTTATTTTTGATAAATAA
AAGCAGCAAATGGGTTTTGGAAATGTTGAAAATAAAATTCAACATTTATAACCACTTAGT
ATGCTAATAGTATTTTCTATCTTCTCTGTTTTCACTTTTATGCTACTCTGCGCAGTAATT
TATAAAGTAATAATTCTTAAGAAAGGTTAATATTAATAAGAATAAGATTAAGAATAAATC
AATCAAACTCTTCTAGGTAATAACATTCAATTAAACTTGTAAGATTTGGAAAGGAGAAGT
AGTTATTCAGCTAGAAGTTCATCTTGA