Identifiers and Description

Gene Model Identifier

TTHERM_00046380

Standard Name

CTH28 (cathepsin 28)

Aliases

PreTt11117 | 3.m01684 | 3824.m02878

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00046380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_129570
Tetrahymena borealisEI9_01811.19.997093137033517e-262eukaryotic aspartyl protease (
2758 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046380(coding)
ATGACTGATTTCACAATCTAATTAATAATAGTATTTATCGCCTGTGCTTTATAGCTTATA
AAATGTGGATATATAAAATCATGGGACATCATAACATTAGATGATTTTAGTGGTACACCT
AATAGATTTTAGATGTATTTTAACCTAGAATCTGGTTTATCTGAGAAGGAGTATATTTAA
ATAAACTTCCCTGATCCAAATATTAAAGTCCTAAGCTCAGATTTGTATCTTTATGAGAGT
TCTCTCCTTTTAGTGTCTGGAGTCAATTGCATAAATTATGTTCCTTCATTAAAAAATTAC
TACTGCTAATACGGAATAGCTTTAAATGCTACAACTTGGTATTCAATAGTCATGCACGTC
GACCCATCATTAATAAATTGGTCAATTTCATAAATTGAACCTGTCGAAATGATTACAGTT
TCAAATACCTGCTATGGTATATTAAATTGTTCACCAATAATATATGATATGAATAATTAC
TTTGGCTATCTCTTAAGAACCCAAATAGGAATTAACATACAAACAACTTTAATAAAAGTG
AGTTTCAATACAACAATAAATTCACAAACAATTCCTGGTTATATATATAATACATATTTG
GATATAACACCAGGAATAAGCTACTATAGTGGTGCTATTTATACAATTACAATTAATCCT
ACAACAACTTTAACAGATCCTATTTTTAACTTTAAATTTGGACTTTCATGTTTCTCAGAC
ATTTTAGATTGTTAAGTTAACTATTCTCCTATGTGCACTTCTATACCATAGATTTAAAAT
TCAACTTGTAGCGTAAACTAAAATCTTAATTAAATTAGTTTCTAGATAAATCAACCAATC
TTTGTTGGTTAAACTTTCAGAATTAATGTTTAAATTTATAATCCTCTCTCTTCTCCTTAA
AAGGCTGATATTAGGGTGCATGGATAGGATATTACTACCTAAAGAACAACAGAGAAAGGA
GTTGCTGCAAATGCTCTTTAGACATAAATTATTTAAATTACAAAGAGTAAATTTAATTTT
ATGTGGGGAATGTCATAATAAGAACAAGGACTATAAAATTCGCCTTATAAGTTGTTTAGT
TCTGTTAATCTTCCTACTGTAAATAGTGTTTACATTTCATTTTAAGTCAACTTAGCTATA
CCAATCGGTTAGGAATATAAAGTTTTAGTATGCTTAGGAAAAGCATTGGGAATAATAGAA
AACTCTATTGTAACTAATCTTCCTGCTTTAAACTTAAACTAATATCCACTCTGCTACCAA
TAAGTCGATTCTTTTAATAATGTTTATGTTGCTTGTGAATAAGTTGGTGCATTGATATAG
TAAAATTAAGATTACTTTGTTTCAGTGAAAGTATCATATGCATCTACAATTTCTATTGCA
TAAGGATATGGAGGAGTTTAAATTTTTTTAAAAAATTATCCAAGCAACAAATTATACAAC
CCATATCCTGGAGAAAATATTAATATTAAAATTAATGATGAATTTTACGATGTTAACGGA
TTTAGTCTGGCGTATGGACTTGGAACTACATAAATCGTTTCTTACACTGATAGTGAATAA
TATTCAGCTGTACCAAATGCAGTAGAAAATTTTCTGTCATCTGATATGTCAAATACCGTT
GGTATAATTCCTTCTGATGTATCAAACTAGCTGCTGCTTTTCTTTTTGAAAGTTGACTAA
AGCTAATTGATTCCTTTATCTACAAGTTTTCCTTAGTATATGATAAGAATGAATATCTTA
TATAATCCTAATGTTATAATTTATGAATAAGGATATGATTAAATGGGTCTCGACTTTGCT
GCCTTTTAAACAGCAACTGCCTCTGATCCAAATAAATGGACTGTTGATTAAATCTAGTGC
TATAATAAATTAAAGTGTTCTTGGTACAATTAGCAAGCAGCTGTGAGTCCTTTAAATTAT
CTTTAAACAAGCCCTCCAACTGCTACCGTTCCATATAATATATAAAGATTCGAATGCATT
TCAACTCAAGTTAGTGATTGCAACAATTGGAGGGGATTTTCAGTTTAATAAAATGGAAAC
GGAGGAGTTTTTGCTATGAGAAGAATTAAGTTTAGAACGGGATTTCACTCATAGCTGTAA
GCTGATGATGATTTATTAGATTTTGTAATATGGTTTGATTATGCTAATTATGCAGCTGGA
ACACCCTTATCATATACAGTATAGTCAGCTTAGCTAATTAATGCATATACAATTTAGCTT
AATCCTCTTAAAACCTCTAAAATAAGTTATATCAACTTCAGTGAGAATTCAATCAACCCA
GGTCACAGATTTCCTACTTTTTTAAGAGTAGGTGGAAGCATAGCTTAAACTGAATACCTA
GGTGCTCCTGCAATAGCAGTTTTTTTTGATGAATCTGTTGAGCTAAAACCCTACTTAAAT
TTCTATAATCCTCAAGGCTAAGCTTAAAAGGATATTGGATGCTCAGCTAACAATTGCTAT
TTTTATAATTCGAATGGAATTAGCGGAAAAGAAACATGGATGAATTACAACATGGTATTG
GCTACAGGACTAACAGATATAGAAAATGATTTTAATTTGTTAATACCAATATAAAATAAA
CTATATGGATCTCAAATTTTAATGCCAAAGCGTCTTGTTGTGGCCTTTTGCGATTTTTCG
AAAACATCAAACGGAGTTCCTAATTAACTTAGAATAGTTAATGTATTTAGGGTGTACGGT
GCTCCTACTTATAGTAATATAGCTAATCCAATTAGCCCTATTTTCTCAGCTATTATCACA
AATGCACCTTTATCATTCACATCTAGTTAATGGTCTGTTACGCCAGCTAACTAAAGTTAA
TATAAACTGGATATGACTAATGTTTAACCTTTAGGCACAGCAAACACTTCTATTTAAGAT
TAAGGCTAAGTCTATCAAAATCATAATAACAATTTTAATCCTGGATAATCAGGAGCAGGT
GTTACTATCTCTTCTTTGTATTATAATGTTTTTGGGCCTAGTACTTTGGGCTTTACAAAC
CCACCTTTCGGAGTGTCATAGTATTGTACTAAATTTAATTATATTTATAATGACATAATA
GGATAATATCCAGACTAAGACAAGTTTACAATATACAACGTATATTGTCCTATTGATGCT
AAGCTATTAGGCACTATATCTATAACTTGGATAAATCCCTTTTTTAGTTACTAATTTGCT
TACTAACTGTAACTCACTCCAATTTTTATGTATTCATTTTCTTCTGGATAAGGCAAAGTT
TATTCGTACTAACAAGAATCATAATCGGTGGCTACATATTATAACACATGTATAGTAAAC
TAAGTCATGAATAATATTTACCCCATGTCAGTAGGTAAATAAGCAGTAGATTTTTCAATT
TAAATCAATGCTAAAACTTCTTTAGATCCTTCTTCATAAACAGGATATGGTTTTTTAGTA
ATCCAAATAAATTTCTCAGTAAATTTATCTTCACTAGCCTTAGCTTCTTCAGTTTGTGAT
TTAAATAACTATTTATCAAATTATTTTACATGTTCAGTTTCTTAATCAACTTAGAAATGG
TAAGTAGTCTTAAAGCCGACCTAAAAATACCTTTTAGATGTAATTGAATATCTCCTTTTC
ACAGTGTATGTTGATGCAAGCTCTTAAGCTTCTGTATCTGGTGTTAAATATGACATTTTA
ATATACTTGCCAACTTAAAAAATTACAGGAGGAAGAGTTTTTGGAAATATTCTTTCAACT
CCCTTAACCACTATTGGAAATTTTATTCTTTTTTCACAATGCTTATCTAATAACTTTTTA
ATGTCTACTTAACCTTATTTGAAAGTGTTGACTATAAATAACTTATAATTTGAAGTTAAA
AATGCAAATTACAAATCTCCTTTTAATTTTACATTTTCTTCATCACCTAGAGAAAGATTT
TATTCTACTTCTTTCTATTCCTTTGACTTTGGATTTTTGATTGCACCGTACTAAGCTATA
CCCTCAAGGAGTAAATTTATAAGATGCTCTGTTTATGAAGCTCCTACATCTATTACTGTA
GTTCCTAACGATTAGTTTAAGTTAAGTTGGAGATGGAGTTATATAGTATATAATGCTAAC
TTGAGAGATATTAGAATATATCCAAAAACTTAATTTAGAAATCCAGATTAATATATTTTT
ACTTTGAAATGCTTAGGAACATACACACCAAGTAGCTCTTCAAGTACTTTTAATATATAA
GGATAATGGATGGATGGAGCAGTAGTAATCCAAACTAGCTAAGTCACTGGTAGCTACTCT
TATGCAATGGCTATTAGTAAAGGTGTTATTGATCCAACCATTTTATCTCCTCTCTACATA
TCTCTTTTCTCTAAATTATTTAACTAATAAGGATTTGAGTCTTCTTACACTTTCTTTATT
AAGCCTACAATAAATTTAAATTATTACACAAGAATCTATATAAATTTCCCTTATTATGTA
GGAGTTGGTGTAAATAGAGAAGTTAATCCTGAGTGTTATACAAGGGTTAAAAATATTCCA
ACACCTATCTAGTATTAAGATTTTAAATTAGCTTATTGTGAGTTAATTAACGATAATAGA
CTAGTCCTTTGGTTTAATTAAAATGTTTATGCAAATATTGAATTCCATATTGTTATCCAT
GGAATATCTTAACCAGAATTGAAAAATAAAGATCCAACAGCTAGTGATAATGAAGTATGG
ATAGGTATCGATGACGATGCTATACTTTCTAATGGTATCAAATAATTTTCCTATATAAGC
ACACCACGCGCTGAACTAACTGTTCCTAGTCAATATTCTTTTATAATTTCTTCAGTTTAA
ATTTCAAATACTTTAATAAGATCTGTTTACAACTTAAATATAGCTTTTGATGTAACTAGT
ACTTAGCTAAGCTCCTCAATTCCAATTTATCTTTAGCTTCCTTCCAGTTTCTCCAATAAT
TAAATAGGATAAGTAATTACATGCACTCTTATTCAAATAAATACAAACACAGTTTTATCA
AATACTGCTTGTGTATTTTTTACCTAAAGACTTATTAAAATAACATTTTCATCAGTTCCA
ACAAATACTTGGTACAGCTATAAGCTATTATTAGAAGGAATATATTCTCCCTAATATATT
CCTGAATAAATTTAAAATTATATCAGACTTTATCTTTTTCAGTCTCCTGATTTGGCAATA
GGTTCTTACACTACAAATGTAGTTGGGATAAGTTTAATTTAATAATCAAATTATTATTCA
TTCACCAATGATACAACTAAAATAGACTTGATTTGGTTTATTTATGGTATGAATAAATAA
GTAAATTCTACAAATATAAATATGATAATACAATCTTAAGTTCTTCTTAACACAAGAACA
GTGATAGTCAACATAGGATATTACAGTAAATTGATAAATCTATAACCTGCAAACAATCAA
ACTTATCTTATATCATTCGGGATTAATCTTTCTGGATTCGCAAATCTTTTTAAATTAAAG
CCCGCTACCCTATTTACAATTAGGGGTAGTAATAATATTTAATTTACAATGGGAGCCTTG
ACAACTACAGCGCCTGGAATTTATTCACTCTCTGCAACTAAAATTAATGATAATGCTAAT
TTATATTCAATAATACCAAACCTAAAAGTAATAGTTAGTTCTGAGGCTTGCTAAATAAAT
GCGAGGTAATACTACTATGAAATTCCTGTAAGTGGTATTTCCTTACCCATTGAATTAGAC
TTTTATAATTGCATGCCGTTAGATAATGTGATATTTACTCCTTTGCTTTAAAATACAAAT
TCTAACAATCTAGACTTCGATTAAAATTACCTTATCAATAAAATTACTGGTACTTCAAAT
GATAGTAGAATGTATTTCTTACTTAAAGATTTAACTCATAATCCCAGTAATGTTAATTTA
TAAATTTTATTGACATTTTAAGTTAGCGGAGTAAACTAATTAGCATACTTACCTCCAAGC
TAAATTACTATAAAGTATATTTCTCAGAACAATGTAGCCCCTTTAGCTTCACCAATCACA
ATTCTATAAGTTTTATAAAATTCTGTCTCTTTATAAATTCAATGCAACTAGCCTGGAATG
GCATTCTGGGTAATAGGCATAGATCCTTCTACATAGAATATAGCTTTTAATGATATTCTA
AATATTGTTACTGGAGTTAAAGGTTTATAACCAACTGTTTCTTCTTATAAAGATCTCAAA
CAAAAAATTTATGGAGTTGATATTTCATATATTAATTAGCCTATTTATAAAACTTTTGAT
AATTTAAAGGCAAATACTTACTACTCATTTAAATATTATTGCTAAAATTAGAATTAACTA
ACTAGTGTATTTTAATCAGTAACTTGGAAAACTCTTAGTAATGGATCATATCTCTTAAAG
ATAACTTTCTTTTTTAATGGCTTGCTTACGTTTCAGTAAACTATGTAAATAACATGCTCA
ATTTAAAAATATTTCACTTTGCCAAGTTAAAGGGTGTTATCAGATAAGGATACACATTGT
AATTAATATCCAAATTACAAGAATTTTAATTATAATAATAGAGATGTTAGGAACCCAATC
AATGCTAACTACCCGTACATGTATTACATTCTTCCTGATTACACAATATAACAAGATAAC
ACTAATTTTTTAATTAAATAACAAATCATAATGAGCAACTTTATAAATAACTTCATTCCC
TATCTTCCAAGTTCTTCAAATTATCCTCAAATAGTTTCTGTTTAAACTTAAGATAATATA
TTTACTCGTACAATTGATATTGCTGTAGCTTAACCAAAACAAGTGTTTACCACCACAGCT
TTAACTTATTTAAAGTTAAAAAATTTGGATGGATTTATTATAGTTGGGATTGAGTAAGGA
AAATCAAATACTTCGCCTTCCCCAGACTAAATTAAGAAAGGATTAAATTTTTATGATTAA
AATTTATTTAGTTTTGAAATGAGATACTGCTAAAGAGAAGTAATCTAAGAATTCAAGTTT
ATCTAACTTTAGCCAGGAACTGATTATACTGCATATTTTATTGGCTCTGTAGATGATCCT
AGCTCAGAAGCTGAAGTAACATAACCTATAATAATTTCTTTCACTACCTAAGATACAATT
CTTGTAGTTTAGACAATTAACGCTAAAGTTTTGAATGTTTGTTTTGTTTTTTTGTTACTA
ATCATACTATAATGA


>TTHERM_00046380(protein)
MTDFTIQLIIVFIACALQLIKCGYIKSWDIITLDDFSGTPNRFQMYFNLESGLSEKEYIQ
INFPDPNIKVLSSDLYLYESSLLLVSGVNCINYVPSLKNYYCQYGIALNATTWYSIVMHV
DPSLINWSISQIEPVEMITVSNTCYGILNCSPIIYDMNNYFGYLLRTQIGINIQTTLIKV
SFNTTINSQTIPGYIYNTYLDITPGISYYSGAIYTITINPTTTLTDPIFNFKFGLSCFSD
ILDCQVNYSPMCTSIPQIQNSTCSVNQNLNQISFQINQPIFVGQTFRINVQIYNPLSSPQ
KADIRVHGQDITTQRTTEKGVAANALQTQIIQITKSKFNFMWGMSQQEQGLQNSPYKLFS
SVNLPTVNSVYISFQVNLAIPIGQEYKVLVCLGKALGIIENSIVTNLPALNLNQYPLCYQ
QVDSFNNVYVACEQVGALIQQNQDYFVSVKVSYASTISIAQGYGGVQIFLKNYPSNKLYN
PYPGENINIKINDEFYDVNGFSLAYGLGTTQIVSYTDSEQYSAVPNAVENFLSSDMSNTV
GIIPSDVSNQLLLFFLKVDQSQLIPLSTSFPQYMIRMNILYNPNVIIYEQGYDQMGLDFA
AFQTATASDPNKWTVDQIQCYNKLKCSWYNQQAAVSPLNYLQTSPPTATVPYNIQRFECI
STQVSDCNNWRGFSVQQNGNGGVFAMRRIKFRTGFHSQLQADDDLLDFVIWFDYANYAAG
TPLSYTVQSAQLINAYTIQLNPLKTSKISYINFSENSINPGHRFPTFLRVGGSIAQTEYL
GAPAIAVFFDESVELKPYLNFYNPQGQAQKDIGCSANNCYFYNSNGISGKETWMNYNMVL
ATGLTDIENDFNLLIPIQNKLYGSQILMPKRLVVAFCDFSKTSNGVPNQLRIVNVFRVYG
APTYSNIANPISPIFSAIITNAPLSFTSSQWSVTPANQSQYKLDMTNVQPLGTANTSIQD
QGQVYQNHNNNFNPGQSGAGVTISSLYYNVFGPSTLGFTNPPFGVSQYCTKFNYIYNDII
GQYPDQDKFTIYNVYCPIDAKLLGTISITWINPFFSYQFAYQLQLTPIFMYSFSSGQGKV
YSYQQESQSVATYYNTCIVNQVMNNIYPMSVGKQAVDFSIQINAKTSLDPSSQTGYGFLV
IQINFSVNLSSLALASSVCDLNNYLSNYFTCSVSQSTQKWQVVLKPTQKYLLDVIEYLLF
TVYVDASSQASVSGVKYDILIYLPTQKITGGRVFGNILSTPLTTIGNFILFSQCLSNNFL
MSTQPYLKVLTINNLQFEVKNANYKSPFNFTFSSSPRERFYSTSFYSFDFGFLIAPYQAI
PSRSKFIRCSVYEAPTSITVVPNDQFKLSWRWSYIVYNANLRDIRIYPKTQFRNPDQYIF
TLKCLGTYTPSSSSSTFNIQGQWMDGAVVIQTSQVTGSYSYAMAISKGVIDPTILSPLYI
SLFSKLFNQQGFESSYTFFIKPTINLNYYTRIYINFPYYVGVGVNREVNPECYTRVKNIP
TPIQYQDFKLAYCELINDNRLVLWFNQNVYANIEFHIVIHGISQPELKNKDPTASDNEVW
IGIDDDAILSNGIKQFSYISTPRAELTVPSQYSFIISSVQISNTLIRSVYNLNIAFDVTS
TQLSSSIPIYLQLPSSFSNNQIGQVITCTLIQINTNTVLSNTACVFFTQRLIKITFSSVP
TNTWYSYKLLLEGIYSPQYIPEQIQNYIRLYLFQSPDLAIGSYTTNVVGISLIQQSNYYS
FTNDTTKIDLIWFIYGMNKQVNSTNINMIIQSQVLLNTRTVIVNIGYYSKLINLQPANNQ
TYLISFGINLSGFANLFKLKPATLFTIRGSNNIQFTMGALTTTAPGIYSLSATKINDNAN
LYSIIPNLKVIVSSEACQINARQYYYEIPVSGISLPIELDFYNCMPLDNVIFTPLLQNTN
SNNLDFDQNYLINKITGTSNDSRMYFLLKDLTHNPSNVNLQILLTFQVSGVNQLAYLPPS
QITIKYISQNNVAPLASPITILQVLQNSVSLQIQCNQPGMAFWVIGIDPSTQNIAFNDIL
NIVTGVKGLQPTVSSYKDLKQKIYGVDISYINQPIYKTFDNLKANTYYSFKYYCQNQNQL
TSVFQSVTWKTLSNGSYLLKITFFFNGLLTFQQTMQITCSIQKYFTLPSQRVLSDKDTHC
NQYPNYKNFNYNNRDVRNPINANYPYMYYILPDYTIQQDNTNFLIKQQIIMSNFINNFIP
YLPSSSNYPQIVSVQTQDNIFTRTIDIAVAQPKQVFTTTALTYLKLKNLDGFIIVGIEQG
KSNTSPSPDQIKKGLNFYDQNLFSFEMRYCQREVIQEFKFIQLQPGTDYTAYFIGSVDDP
SSEAEVTQPIIISFTTQDTILVVQTINAKVLNVCFVFLLLIILQ


>TTHERM_00046380(gene)
ATGACTGATTTCACAATCTAATTAATAATAGTATTTATCGCCTGTGCTTTATAGCTTATA
AAATGTGGATATATAAAATCATGGGACATCATAACATTAGATGATTTTAGTGGTACACCT
AATAGATTTTAGATGTATTTTAACCTAGAATCTGGTTTATCTGAGAAGGAGTATATTTAA
ATAAACTTCCCTGATCCAAATATTAAAGTCCTAAGCTCAGATTTGTATCTTTATGAGAGT
TCTCTCCTTTTAGTGTCTGGAGTCAATTGCATAAATTATGTTCCTTCATTAAAAAATTAC
TACTGCTAATACGGAATAGCTTTAAATGCTACAACTTGGTATTCAATAGTCATGCACGTC
GACCCATCATTAATAAATTGGTCAATTTCATAAATTGAACCTGTCGAAATGATTACAGTT
TCAAATACCTGCTATGGTATATTAAATTGTTCACCAATAATATATGATATGAATAATTAC
TTTGGCTATCTCTTAAGAACCCAAATAGGAATTAACATACAAACAACTTTAATAAAAGTG
AGTTTCAATACAACAATAAATTCACAAACAATTCCTGGTTATATATATAATACATATTTG
GATATAACACCAGGAATAAGCTACTATAGTGGTGCTATTTATACAATTACAATTAATCCT
ACAACAACTTTAACAGGTAATTAAATTTGAGGCTTTAATTAAATAGAAATTAAGATTAAG
CACAAATTTTATAAAATATTTTTGTGGTTTTCAAAAAAATAAATTAATATTTTTAAAAAA
TAAATAACAGATCCTATTTTTAACTTTAAATTTGGACTTTCATGTTTCTCAGACATTTTA
GATTGTTAAGTTAACTATTCTCCTATGTGCACTTCTATACCATAGGTATTCTAAATTAAT
TAAAAATATATATTAAATAACTAATTTTAAATATAGATTTAAAATTCAACTTGTAGCGTA
AACTAAAATCTTAATTAAATTAGTTTCTAGATAAATCAACCAATCTTTGTTGGTTAAACT
TTCAGAATTAATGTTTAAATTTATAATCCTCTCTCTTCTCCTTAAAAGGCTGATATTAGG
GTGCATGGATAGGATATTACTACCTAAAGAACAACAGAGAAAGGAGTTGCTGCAAATGCT
CTTTAGACATAAATTATTTAAATTACAAAGAGTAAATTTAATTTTATGTGGGGAATGTCA
TAATAAGAACAAGGACTATAAAATTCGCCTTATAAGTTGTTTAGTTCTGTTAATCTTCCT
ACTGTAAATAGTGTTTACATTTCATTTTAAGTCAACTTAGCTATACCAATCGGTTAGGAA
TATAAAGTTTTAGTATGCTTAGGAAAAGCATTGGGAATAATAGAAAACTCTATTGTAACT
AATCTTCCTGCTTTAAACTTAAACTAATATCCACTCTGCTACCAATAAGTCGATTCTTTT
AATAATGTTTATGTTGCTTGTGAATAAGTAATTTTTTTATAAATTTTGGAATAATAATGA
TCTTTTTGTTTTAATTCATTTAGGTTGGTGCATTGATATAGTAAAATTAAGATTACTTTG
TTTCAGTGAAAGTATCATATGCATCTACAATTTCTATTGCATAAGGATATGGAGGAGTTT
AAATTTTTTTAAAAAATTATCCAAGCAACAAATTATACAACCCATATCCTGGAGAAAATA
TTAATATTAAAATTAATGATGAATTTTACGATGTTAACGGATTTAGTCTGGCGTATGGAC
TTGGAACTACATAAATCGTTTCTTACACTGATAGTGAATAATATTCAGCTGTACCAAATG
CAGTAGAAAATTTTCTGTCATCTGATATGTCAAATACCGTTGGTATAATTCCTTCTGATG
TATCAAACTAGCTGCTGCTTTTCTTTTTGAAAGTTGACTAAAGCTAATTGATTCCTTTGT
AAGATTTTTATAAATATAAAATCATTATATTTATTAAAGTATATAAATTACTATTTTAAA
ATCAAAAGATCTACAAGTTTTCCTTAGTATATGATAAGAATGAATATCTTATATAATCCT
AATGTTATAATTTATGAATAAGGATATGATTAAATGGGTCTCGACTTTGCTGCCTTTTAA
ACAGCAACTGCCTCTGATCCAAATAAATGGACTGTTGATTAAATCTAGTGCTATAATAAA
TTAAAGTGTTCTTGGTACAATTAGCAAGCAGCTGTGAGTCCTTTAAATTATCTTTAAACA
AGCCCTCCAACTGCTACCGTTCCATATAATATATAAAGATTCGAATGCATTTGTAAATAT
TTTTTTTTCTTTGACTTAAGTTAATAAAAATCTTATTATAATAGCAACTCAAGTTAGTGA
TTGCAACAATTGGAGGGGATTTTCAGTTTAATAAAATGGAAACGGAGGAGTTTTTGCTAT
GAGAAGAATTAAGTTTAGAACGGGATTTCACTCATAGCTGTAAGCTGATGATGATTTATT
AGATTTTGTAATATGGTTTGATTATGCTAATTATGCAGCTGGAACACCCTTATCATATAC
AGTATAGTCAGCTTAGCTAATTAATGCATATACAATTTAGCTTAATCCTCTTAAAACCTC
TAAAATAAGTTATATCAACTTCAGTGAGAATTCAATCAACCCAGGTCACAGATTTCCTAC
TTTTTTAAGAGTAGGTGGAAGCATAGCTTAAACTGAATACCTAGGTGCTCCTGCAATAGC
AGTATCCATATTTATTGTATGTTTAACTTTTAATAATATATAAAATTTATAAAGGTTTTT
TTTGATGAATCTGTTGAGCTAAAACCCTACTTAAATTTCTATAATCCTCAAGGCTAAGCT
TAAAAGGATATTGGATGCTCAGCTAACAATTGCTATTTTTATAATTCGAATGGAATTAGC
GGAAAAGAAACATGGATGAATTACAACATGGTATTGGCTACAGGACTAACAGATATAGAA
AATGATTTTAATTTGTTAATACCAATATAAAATAAACTATATGGATCTCAAATTTTAATG
CCAAAGCGTCTTGTTGTGGCCTTTTGCGATTTTTCGAAAACATCAAACGGAGTTCCTAAT
TAACTTAGAATAGTTAATGTATTTAGGGTGTACGGTGCTCCTACTTATAGTAATATAGCT
AATCCAATTAGCCCTATTTTCTCAGCTATTATCACAAATGCACCTTTATCATTCACATCT
AGTTAATGGTCTGTTACGCCAGGTAATTGAATAAAATATTTGATATAATTTTAATATATT
ATTGTATAAAAAAGCTAACTAAAGTTAATATAAACTGGATATGACTAATGTTTAACCTTT
AGGCACAGCAAACACTTCTATTTAAGATTAAGGCTAAGTCTATCAAAATCATAATAACAA
TTTTAATCCTGGATAATCAGGAGCAGGTGTTACTATCTCTTCTTTGTATTATAATGTTTT
TGGGCCTAGTACTTTGGGCTTTACAAACCCACCTTTCGGAGTGTCATAGTATTGTACTAA
ATTTAATTATATTTATAATGACATAATAGGATAATATCCAGACTAAGACAAGTTTACAAT
ATACAACGTATATTGTCCTATTGATGCTAAGCTATTAGGCACTATATCTATAACTTGGAT
AAATCCCTTTTTTAGTTACTAATTTGCTTACTAACTGTAACTCACTCCAATTTTTATGTA
TTCATTTTCTTCTGGATAAGGCAAAGTTTATTCGTACTAACAAGAATCATAATCGGTGGC
TACATATTATAACACATGTATAGTAAACTAAGTCATGAATAATATTTACCCCATGTCAGT
AGGTAAATAAGCAGTAGATTTTTCAATTTAAATCAATGCTAAAACTTCTTTAGATCCTTC
TTCATAAACAGGATATGGTTTTTTAGTAATCCAAATAAATTTCTCAGTAAATTTATCTTC
ACTAGCCTTAGCTTCTTCAGTTTGTGATTTAAATAACTATTTATCAAATTATTTTACATG
TTCAGTTTCTTAATCAACTTAGAAATGGTAAGTAGTCTTAAAGCCGACCTAAAAATACCT
TTTAGATGTAATTGAATATCTCCTTTTCACAGTGTATGTTGATGGTAATCAAATTATTTT
AGAAAATTAAATTTACTTTAAATTTCAAAAATTTATTGCTAAACATAATTTTTTTTTTAA
TTATAAAAGCAAGCTCTTAAGCTTCTGTATCTGGTGTTAAATATGACATTTTAATATACT
TGCCAACTTAAAAAATTACAGGAGGAAGAGTTTTTGGAAATATTCTTTCAACTCCCTTAA
CCACTATTGGAAATTTTATTCTTTTTTCACAATGCTTATCTAATAACTTTTTAATGTCTA
CTTAACCTTATTTGAAAGTGTTGACTATAAATAACTTATAATTTGAAGTTAAAAATGCAA
ATTACAAATCTCCTTTTAATTTTACATTTTCTTCATCACCTAGAGAAAGATTTTATTCTA
CTTCTTTCTATTCCTTTGACTTTGGATTTTTGATTGCACCGTACTAAGCTATACCCTCAA
GGAGTAAATTTATAAGGTAAATTTTTTTTACTATCTTCTATATAAATGCTTATCTTACCT
AAATATTTAAAATCTTATGAAAAAAATTATTTCAGTAACAATATTACTTATTTATAACAT
ATTTTTCATTTATCTTAATAATCAGATGCTCTGTTTATGAAGCTCCTACATCTATTACTG
TAGTTCCTAACGATTAGTTTAAGTTAAGTTGGAGATGGAGTTATATAGTATATAATGCTA
ACTTGAGAGATATTAGAATATATCCAAAAACTTAATTTAGAAATCCAGATTAATATATTT
TTACTTTGAAATGCTTAGGAACATACACACCAAGTAGCTCTTCAAGTACTTTTAATATAT
AAGGATAATGGATGGATGGAGCAGTAGTAATCCAAACTAGCTAAGTCACTGGTAGCTACT
CTTATGCAATGGCTATTAGTAAAGGTGTTATTGATCCAACCATTTTATCTCCTCTCTACA
TATCTCTTTTCTCTAAATTATTTAACTAATAAGGATTTGAGTCTTCTTACACTTTCTTTA
TTAAGCCTACAATAAATTTAAATTATTACACAAGAATCTATATAAATTTCCCTTATTATG
TAGGAGTTGGTGTAAATAGAGAAGTTAATCCTGAGTGTTATACAAGGGTTAAAAATATTC
CAACACCTATCTAGTATTAAGATTTTAAATTAGCTTATTGTGAGTTAATTAACGATAATA
GACTAGTCCTTTGGTTTAATTAAAATGTTTATGCAAATATTGAATTCCATATTGTTATCC
ATGGAATATCTTAACCAGAATTGAAAAATAAAGATCCAACAGCTAGTGATAATGAAGTAT
GGATAGGTATCGATGACGATGCTATACTTTCTAATGGTATCAAATAATTTTCCTATATAA
GCACACCACGCGCTGAACTAACTGTTCCTAGTCAATATTCTTTTATAATTTCTTCAGTTT
AAATTTCAAATACTTTAATAAGATCTGTTTACAACTTAAATATAGCTTTTGATGTAACTA
GTACTTAGCTAAGCTCCTCAATTCCAATTTATCTTTAGCTTCCTTCCAGTTTCTCCAATA
ATTAAATAGGATAAGTAATTACATGCACTCTTATTCAAATAAATACAAACACAGTTTTAT
CAAATACTGCTTGTGTATTTTTTACCTAAAGACTTATTAAAATAACATTTTCATCAGTTC
CAACAAATACTTGGTACAGCTATAAGCTATTATTAGAAGGAATATATTCTCCCTAATATA
TTCCTGAATAAATTTAAAATTATATCAGACTTTATCTTTTTCAGTCTCCTGATTTGGCAA
TAGGTTCTTACACTACAAATGTAGTTGGGATAAGTTTAATTTAATAATCAAATTATTATT
CATTCACCAATGATACAACTAAAATAGACTTGATTTGGTTTATTTATGGTATGAATAAAT
AAGTAAATTCTACAAATATAAATATGATAATACAATCTTAAGTTCTTCTTAACACAAGAA
CAGTGATAGTCAACATAGGATATTACAGTAAATTGATAAATCTATAACCTGCAAACAATC
AAACTTATCTTATATCATTCGGGATTAATCTTTCTGGATTCGCAAATCTTTTTAAATTAA
AGCCCGCTACCCTATTTACAATTAGGGGTAGTAATAATATTTAATTTACAATGGGAGCCT
TGACAACTACAGCGCCTGGAATTTATTCACTCTCTGCAACTAAAATTAATGATAATGCTA
ATTTATATTCAATAATACCAAACCTAAAAGTAATAGTTAGTTCTGAGGCTTGCTAAATAA
ATGCGAGGTAATACTACTATGAAATTCCTGTAAGTGGTATTTCCTTACCCATTGAATTAG
ACTTTTATAATTGCATGCCGTTAGATAATGTGATATTTACTCCTTTGCTTTAAAATACAA
ATTCTAACAATCTAGACTTCGATTAGTAAATCAATTCTTTCATTTTTATATAATAAATTT
ATATTTTGAATTAAATAATAGAAATTACCTTATCAATAAAATTACTGGTACTTCAAATGA
TAGTAGAATGTATTTCTTACTTAAAGATTTAACTCATAATCCCAGTAATGTTAATTTATA
AATTTTATTGACATTTTAAGTTAGCGGAGTAAACTAATTAGCATACTTACCTCCAAGCTA
AATTACTATAAAGTATATTTCTCAGAACAATGTAGCCCCTTTAGCTTCACCAATCACAAT
TCTATAAGTTTTATAAAATTCTGTCTCTTTATAAATTCAATGCAACTAGCCTGGAATGGC
ATTCTGGGTAATAGGTAACCTAAAACAATTAAATAATTATATTATTATAGAATTTGCTAG
TTAAAGTAGTATTTTTACAATATTAAATAAATGACATAGCTGTTGATTATCTTTAATTTA
TTTTTTAAATTAAACTTTAATTATTATATAATTTAACAAAGATTTAATTAATATTCATGA
TAATTTTTAGTTTTAATTTATTTATTTTCGAATAAAAGGCATAGATCCTTCTACATAGAA
TATAGCTTTTAATGATATTCTAAATATTGTTACTGGAGTTAAAGGTTTATAACCAACTGT
TTCTTCTTATAAAGATCTCAAACAAAAAATTTATGGAGTTGATATTTCATATATTAATTA
GCCTATTTATAAAACTTTTGATAATTTAAAGGCAAATACTTACTACTCATTTAAATATTA
TTGCTAAAATTAGAATTAACTAACTAGTGTATTTTAATCAGTAACTTGGAAAACTCTTAG
TAATGGATCATATCTCTTAAAGATAACTTTCTTTTTTAATGGCTTGCTTACGTTTCAGTA
AACTATGTAAATAACATGCTCAATTTAAAAATATTTCACTTTGCCAAGTTAAAGGGTGTT
ATCAGATAAGGATACACATTGTAATTAATATCCAAATTACAAGAATTTTAATTATAATAA
TAGAGATGTTAGGAACCCAATCAATGCTAACTACCCGTAATTATTCATAAAATTGGTTTT
TACTTAAATATAAATATATATATAATTTAAAAATTAGGTACATGTATTACATTCTTCCTG
ATTACACAATATAACAAGATAACACTAATTTTTTAATTAAATAACAAATCATAATGAGCA
ACTTTATAAATAACTTCATTCCCTATCTTCCAAGTTCTTCAAATTATCCTCAAATAGTTT
CTGTTTAAACTTAAGATAATATATTTACTCGTACAATTGATATTGCTGTAGCTTAACCAA
AACAAGTGTTTACCACCACAGCTTTAACTTATTTAAAGTTAAAAAATTTGGATGGATTTA
TTATAGTTGGGATTGAGTAAGGAAAATCAAATACTTCGCCTTCCCCAGACTAAATTAAGA
AAGGATTAAATTTTTATGATTAAAATTTATTTAGTTTTGAAATGAGATACTGCTAAAGAG
AAGTAATCTAAGAATTCAAGTTTATCTAACTTTAGCCAGGAACTGAGTAAATAAATTTTA
ATATATTCTTATTTTTCTCATAAATTATTTTCAAATTATAGTTATACTGCATATTTTATT
GGCTCTGTAGATGATCCTAGCTCAGAAGCTGAAGTAACATAACCTATAATAATTTCTTTC
ACTACCTAAGATACAATTCTTGTAGTTTAGACAATTAACGCTAAAGTTTTGAATGTTTGT
TTTGTTTTTTTGTTACTAATCATACTATAATGA