Identifiers and Description

Gene Model Identifier

TTHERM_00600720

Standard Name

CTH27 (CaTHepsin 27)

Aliases

PreTt22135 | 83.m00204 | 3685.m00096

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 68.1%

TetraMine Data

TTHERM_00600720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14934.13.0011260078469234e-135PCI domain-containing protein
(2003 aa)
OxytrichaContig18566.0.g988.00284826019147e-27Eukaryotic aspartyl protease
SGDYPL154C1.9999391735788327e-19PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
WormBaseWBGene000002163.001003044337619e-17locus:asp-3 Aspartic proteas
e 3 status:Confirmed UniPr
ot:P55956 protein_id:CCD7241
5.2
DictyBaseDDB_G02794110.00000000000001000191320216021ctsD on chromosome: 3 position
2104523 to 2105867
Stentor CoeruleusSteCoe_318270.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600720(coding)
ATGAACAAAGTTATTTCATTAATTTTGCTCATTTTAACATGTAGTCATGTTTCTTTTGCG
CTAATTAAAGTTAGCATAATAAGAGAATATAAGCCACATTAAAAATATGAAAGATTCCTG
AGCTCTGATGCTAATGTATAAGCTAGTCAGAGCAATAAAGTAGTTTCACTTGAAAACTAC
TTTTAGATGAAATACTTTGGTACTATATATGTTGGTAAGAATTAACAAAAGATGAAAATG
CTTTTTGATTCAGGATCAGATACGATGTGGATAGGATCTAAAACTTGCAATACTTGTAGA
GATAGTGGCATAAATAATTTATATGACTGTATAGAAACTAATGGCTGTAAGTATACAGGA
GACCCTATAGAGACAATTAGATATTTAAAAGGTTAGGTAGATGGATATCTAGCTAGTACC
ATTGTAAACTTCAGCAATAATAATTCTGCATCTCCTTTCGATTTCAATTTGCTTTTGATT
ACTAATGTAAAGGATCTAGAATCCTATGATGCAGATGGAATTATTGGATTGACTTACTAG
GTAAGCTATAAAAGATAAGATACAAGAAGTCCTTTTGTTAAAGAACTGTTCTAAAGGAAG
ATAATTAACGATTAAAGTTTTTCAGTATATCTCGGCTTTAAGAAAGATGATTCAGAAATA
ACATTTGGAGGCATAAATCAAGACAAAGTTAATCCTGGTTCCAATTTCATTTATTATTTA
GTACCTCCTATTTAAGCAATGTTTTGGGAAATAAGCGTTTAGAGCTTAATCTTAGGAAGT
TAATCTTATGACATGTCCTCTAGTACTACTATAGTCGACTCAGGCACTTCAGTCTTATGT
TTTGAGACTTAGACATTCAATAATGTATATGAATTTTTAAAGTAAAATGTAAATGGGCTT
TAAAGAAAAGATTTATACTTCACATATAAATGTGGCTAACCTCTTCCAAATATTTACTTT
ACTATAATTAGTGCAGATGGAAAAAAATACAAATATTCTATAGAATCAGACTACTATACT
ATTAAACTTAATGGTGATTGTGCTATCCTTATTGATTTGTGCCCAAACAATAACATTCTT
GGAGAAGTATTTATGAGAAAATACGTAACCCATTTCAAGTATAATTACAAAGATAATAAA
GATGCAATAGGTTTTGCATTGTCTATTGCAGATCCTAAAGATAACTATCTTAATGATTCT
GAAAATTAAGATTACACAAAATATTATATACTTGGTGGAGTTGGTGCAGGTGTAATTATA
TTAATTGTAATTGTAATTTATTACTTTAGAAGAAGAAAAATAAAGTAAAATATGATGAAA
CAGAATGAGTAATTATATTAAAAGAATGTTAATAATACAGATATTAGCTCTAAATCTTGA


>TTHERM_00600720(protein)
MNKVISLILLILTCSHVSFALIKVSIIREYKPHQKYERFLSSDANVQASQSNKVVSLENY
FQMKYFGTIYVGKNQQKMKMLFDSGSDTMWIGSKTCNTCRDSGINNLYDCIETNGCKYTG
DPIETIRYLKGQVDGYLASTIVNFSNNNSASPFDFNLLLITNVKDLESYDADGIIGLTYQ
VSYKRQDTRSPFVKELFQRKIINDQSFSVYLGFKKDDSEITFGGINQDKVNPGSNFIYYL
VPPIQAMFWEISVQSLILGSQSYDMSSSTTIVDSGTSVLCFETQTFNNVYEFLKQNVNGL
QRKDLYFTYKCGQPLPNIYFTIISADGKKYKYSIESDYYTIKLNGDCAILIDLCPNNNIL
GEVFMRKYVTHFKYNYKDNKDAIGFALSIADPKDNYLNDSENQDYTKYYILGGVGAGVII
LIVIVIYYFRRRKIKQNMMKQNEQLYQKNVNNTDISSKS


>TTHERM_00600720(gene)
ATGAACAAAGTTATTTCATTAATTTTGCTCATTTTAACATGTAGTCATGTTTCTTTTGCG
CTAATTAAAGTTAGCATAATAAGAGAATATAAGCCACATTAAAAATATGAAAGATTCCTG
AGCTCTGATGCTAATGTATAAGCTAGTCAGAGCAATAAAGTAGTTTCACTTGAAAACTAC
TTTTAGATGAAATACTTTGGTACTATATATGTTGGTAAGAATTAACAAAAGATGAAAATG
CTTTTTGATTCAGGATCAGATACGATGTGGATAGGATCTAAAACTTGCAATACTTGTAGA
GATAGTGTAATTTTCAACTAATTTTTATCATAAACTCAAAATGAGTAGATAATTTTATAG
TTTATTGAATAGCTATTTGCCTAATAACTGATTTTGTTTATCTATCTTAAAAAATTAGGG
CATAAATAATTTATATGACTGTATAGAAACTAATGGCTGTAAGTATACAGGAGACCCTAT
AGAGACAATTAGATATTTAAAAGGTTAGGTAGATGGATATCTAGCTAGTACCATTGTAAA
CTTCAGCAATAATAATTCTGCATCTCCTTTCGATTTCAATTTGCTTTTGATTACTAATGT
AAAGGATCTAGAATCCTATGATGTAATTATATTTATTTATTTGAGAAAATATTTATTTTA
AATTGATAATTAACTTCTAATTTATTATTATTTTGATTAATTTAAACACATATATTTTTA
TCATTTCAATAAGGCAGATGGAATTATTGGATTGACTTACTAGGTAAGCTATAAAAGATA
AGATACAAGAAGTCCTTTTGTTAAAGAACTGTTCTAAAGGAAGATAATTAACGATTAAAG
TTTTTCAGTATATCTCGGCTTTAAGAAAGATGATTCAGAAATAACATTTGGAGGCATAAA
TCAAGACAAAGTTAATCCTGGTTCCAATTTCATTTATTATTTAGTACCTCCTATTTAAGC
AATGTTTTGGGAAATAAGCGTTTAGAGCTTAATCTTAGGAAGTTAATCTTATGACATGTC
CTCTAGTACTACTATAGTCGACTCAGGCACTTCAGTCTTATGTTTTGAGACTTAGACATT
CAATAATGTATATGAATTTTTAAAGTAAAATGTAAATGGGCTTTAAAGAAAAGATTTATA
CTTCACATATAAATGTGGCTAACCTCTTCCAAATATTTACTTTACTATAATTAGTGCAGA
TGGAAAAAAATACAAATATTCTATAGAATCAGACTACTATACTATTAAACTTAATGGTGA
TTGTGCTATCCTTATTGATTTGTGCCCAAACAATAACATTCTTGGAGAAGTATTTATGAG
AAAATACGTAACCCATTTCAAGTATAATTACAAAGATAATAAAGATGCAATAGGTAAAGA
AATATTTTAACAAATTATCATAATAAAAAAATATTTTAATTAAAAGCGTTTATTAATAAA
TAATAAAAAATAATATTTTAAATACTACTTTATTCAACTAAAACAAAAAAATAAATTAAA
TATTTTATAATAATAATTTCAAAAATAAAAAATAAATAGATAGATGGATTTAGAATTTAC
TTTTGATTAAAACCCTTTATTCTTTGATATATTTTAAAGCATATTAAATTATTTTGAGTT
TAAAGTTATTTTCTTAAGCCGTTTTTTAAAGTATTTTTAAGTTTAAATTGAGTTTAAGAA
TTGAAACTAGAAATTAAAAAATATTTCATAATGATATTACACAGATTTACTCTTTTTATT
GATCTTAAGTGTAATTTATTTTATAAAAAGGTTTTGCATTGTCTATTGCAGATCCTAAAG
ATAACTATCTTAATGATTCTGAAAATTAAGATTACACAAAATATTATATACTTGGTGGAG
TTGGTGCAGGTGTAATTATATTAATTGTAATTGTAATTTATTACTTTAGAAGAAGAAAAA
TAAAGTAAAATATGATGAAACAGAATGAGTAATTATATTAAAAGAATGTTAATAATACAG
ATATTAGCTCTAAATCTTGA