Identifiers and Description

Gene Model Identifier

TTHERM_00561540

Standard Name

CTH26 (cathepsin 25)

Aliases

PreTt27915 | 74.m00192 | 3720.m00082

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF06365 ) CD34/Podocalyxin family
  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 73.3%

TetraMine Data

TTHERM_00561540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16131.11.999469658314961e-75hypothetical protein (506 aa)
OxytrichaContig17270.0.g429.995317835403734e-19Eukaryotic aspartyl protease
WormBaseWBGene000139732.000769134519826e-18locus:asp-18 status:Predicte
d UniProt:Q7JKL9 protein_i
d:CAB05013.2
DictyBaseDDB_G02794114.0002685161515803e-16ctsD on chromosome: 3 position
2104523 to 2105867
SGDYPL154C0.00000000006996681903814525PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
Stentor CoeruleusSteCoe_46130.00000011253517471925912

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561540(coding)
ATGTAATAATTATTTACATACATTTTAATCACAATCTTATCTCTTAGTCAAGCATAGATT
TTACAAATTCCTCTTAGCTTCTCAAAAAAATAAAATGAAATCCAAGCCTTAAATTCTTAA
AGACTTAGAAGCTTACAGTAGGATAGCGCTAATCTCAACTTAAATGTTATAAGTGATACA
AATTAGTCGTTTTACTATGGAAAAATTCAATTAGGCAATGGTAAAAATAACAGCTTCGAT
GTTTTCTTTGACACAACTTCTTCTTTTAGTTGGATTCCTAGCTCTTCTTGCACAAGCGAT
TCTTGCCAAGGATTTAACAAGACATATCTCTGTATTTATAGTGATATGTGTTACCAAGAT
AATAAATAAGCACTATCTAATTACAATTACTCTGGTGGGCAATTGTATGGATAATAAATA
ATCGCAACATTACAAATTTCTGGATTAACATCTTAAAACACACAATTCTATTCTGCAAAT
CAAATTTTAAATCTTGAAAATTTACCAGTAGATGGTGTTATAGGAATGTAATTGTTAAAA
TCATAGAACAAAAGCTAGGAATCTTTTCTTTCAATCATTCAATCTGAAGGAAAAATAAAA
GTGCCTATGTTTTCTTTATTCTTGAACTAAAAAGAAGGCTCTAAAATTACTTTAGGAGGT
TTTGATCCAGCCTCAATAATGGATTAAAAAAAAATATATTATCATAAAGTGATATCAAAA
AATCAGACAGATGAAACCTTCCAATGGGCTGTAAGAGGAGATGAATTAAAAATAGGATCT
TATTCAGCTAGCTTAAATGCAACATAAAAATAAATTCTAATTTCTTCAGTAGACTAATTT
ATTGGATTGAACTAAGACATTTTCAATGATTTGATGAATTATCTCACAAAATAATACAAA
GTATTTTAAAATTAAGGATATTATTTTGTCGACTGTAAATAAATCATGCCTCCAATTTTA
ATCGCATTGCCTGACTCTAATAGTACAAGCAGGATATATAATCTTACATCGGATTATTAT
ATAAATAATACTACCTAGACATGCTAATTAATGATTAAATCATTAGAAAATCCAGATCTT
AATATGATTCTGGGAACATCTTTCCTTGAAAAATATGTCTCAATTTTTACAATTTCAAAT
TCAACAATAGGATTTGCCTAGTCTGTTTAAAATCAATAAAAGCATTAAAGTCCTTTAGAT
TAAGTATTATGTATAATAATAGTGTCAATATGTTGTAGTATTCTACTGATTATTATTGGA
GTTTGTTTTTACAAGCAATGCAAAATAAATAAATCTAAGCTAAAAAATGGTGTTTTACTT
AAAGAATAACATACAGATAATAAAGAAAGCGATTAAAACACAATCAAAAACCCAATTTTT
AATACAAATTAAAATCAAAATCATGATTCTTCATTTATAATTTGTAGCTAAAATCTGAAA
TCTGAAAATAAAAAAGGATAATGTGTTCTAGAAGAAAATAATGATAATCACCAAGATAAC
TTATGA


>TTHERM_00561540(protein)
MQQLFTYILITILSLSQAQILQIPLSFSKKQNEIQALNSQRLRSLQQDSANLNLNVISDT
NQSFYYGKIQLGNGKNNSFDVFFDTTSSFSWIPSSSCTSDSCQGFNKTYLCIYSDMCYQD
NKQALSNYNYSGGQLYGQQIIATLQISGLTSQNTQFYSANQILNLENLPVDGVIGMQLLK
SQNKSQESFLSIIQSEGKIKVPMFSLFLNQKEGSKITLGGFDPASIMDQKKIYYHKVISK
NQTDETFQWAVRGDELKIGSYSASLNATQKQILISSVDQFIGLNQDIFNDLMNYLTKQYK
VFQNQGYYFVDCKQIMPPILIALPDSNSTSRIYNLTSDYYINNTTQTCQLMIKSLENPDL
NMILGTSFLEKYVSIFTISNSTIGFAQSVQNQQKHQSPLDQVLCIIIVSICCSILLIIIG
VCFYKQCKINKSKLKNGVLLKEQHTDNKESDQNTIKNPIFNTNQNQNHDSSFIICSQNLK
SENKKGQCVLEENNDNHQDNL


>TTHERM_00561540(gene)
ATGTAATAATTATTTACATACATTTTAATCACAATCTTATCTCTTAGTCAAGCATAGATT
TTACAAATTCCTCTTAGCTTCTCAAAAAAATAAAATGAAATCCAAGCCTTAAATTCTTAA
AGACTTAGAAGCTTACAGTAGGATAGCGCTAATCTCAACTTAAATGTTATAAGTGATACA
AATTAGTCGTTTTACTATGGAAAAATTCAATTAGGCAATGGTAAAAATAACAGCTTCGAT
GTTTTCTTTGACACAACTTCTTCTTTTAGTTGGATTCCTAGCTCTTCTTGCACAAGCGAT
TCTTGCCAAGTAACTCAAAACTTTATTTTACATACCTTTTAAAATATTTTGTTTTAATTA
TAATTAGGGATTTAACAAGACATATCTCTGTATTTATAGTGATATGTGTTACCAAGATAA
TAAATAAGCACTATCTAATTACAATTACTCTGGTGGGCAATTGTATGGATAATAAATAAT
CGCAACATTACAAATTTCTGGATTAACATCTTAAAACACACAATTCTATTCTGCAAATCA
AATTTTAAATCTTGAAAATTTACCAGTAATAAATAAATAAATAAATAAATAATAAAATTG
TTTAAATACAAAAATATTTTATTTTTTTCAAAAATTATTTTTAGGTAGATGGTGTTATAG
GAATGTAATTGTTAAAATCATAGAACAAAAGCTAGGAATCTTTTCTTTCAATCATTCAAT
CTGAAGGAAAAATAAAAGTGCCTATGTTTTCTTTATTCTTGAACTAAAAAGAAGGCTCTA
AAATTACTTTAGGAGGTTTTGATCCAGCCTCAATAATGGATTAAAAAAAAATATATTATC
ATAAAGTGATATCAAAAAATCAGACAGATGAAACCTTCCAATGGGCTGTAAGAGGAGATG
AATTAAAAATAGGATCTTATTCAGCTAGCTTAAATGCAACATAAAAATAAATTCTAATTT
CTTCAGTAGACTAATTTATTGGATTGAACTAAGACATTTTCAATGATTTGATGAATTATC
TCACAAAATAATACAAAGTATTTTAAAATTAAGGATATTATTTTGTCGACTGTAAATAAA
TCATGCCTCCAATTTTAATCGCATTGCCTGACTCTAATAGTACAAGCAGGATATATAATC
TTACATCGGATTATTATATAAATAATACTACCTAGACATGCTAATTAATGATTAAATCAT
TAGAAAATCCAGATCTTAATATGATTCTGGGAACATCTTTCCTTGAAAAATATGTCTCAA
TTTTTACAATTTCAAATTCAACAATAGGTAATTAATTATTTTGATTAATTTAAATTTACT
TGATATTTATAAATTTTAAACACTATATGAAATGTATTAATAATAAATTTTCTAAAATAG
TAAAAAATTAAAATTTTAAATTAAATATTTACAAAATAAAAAATCTAAAATCTTTAAAAT
GAAAAAATTTAAATATATTATAGATCACTGTTTCAATAATATATTTATTTGTCTTATGTA
ATATTTTTAATTTTTATTAAATAGGATTTGCCTAGTCTGTTTAAAATCAATAAAAGCATT
AAAGTCCTTTAGATTAAGTATTATGTATAATAATAGTGTCAATATGTTGTAGTATTCTAC
TGATTATTATTGGAGTTTGTTTTTACAAGCAATGCAAAATAAATAAATCTAAGCTAAAAA
ATGGTGTTTTACTTAAAGAATAACATACAGATAATAAAGAAAGCGATTAAAACACAATCA
AAAACCCAATTTTTAATACAAATTAAAATCAAAATCATGATTCTTCATTTATAATTTGTA
GCTAAAATCTGAAATCTGAAAATAAAAAAGGATAATGTGTTCTAGAAGAAAATAATGATA
ATCACCAAGATAACTTATGA