Identifiers and Description

Gene Model Identifier

TTHERM_00678540

Standard Name

CTH25 (cathepsin 25)

Aliases

PreTt07618 | 102.m00138 | 3730.m00065

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00678540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16358.11.9998298245723724e-130hypothetical protein (1125 aa)
OxytrichaContig3196.0.g1055.002171138422328e-22Eukaryotic aspartyl protease
WormBaseWBGene000002162.0004286606204839e-16locus:asp-3 Aspartic proteas
e 3 status:Confirmed UniPr
ot:P55956 protein_id:CCD7241
5.2
SGDYPL154C9.997764199084386e-16PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
Stentor CoeruleusSteCoe_137040.000000000005109089028063325
DictyBaseDDB_G02794110.0000000029989608248573072ctsD on chromosome: 3 position
2104523 to 2105867

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00678540(coding)
ATGATAATTAAACAAATAGTAACCTTTGCTTTGCTTTTAATACTAAGCAAGGCGGAAATC
ATAAAAATTCAACTCAAAAAATAGACAATAACCTAACTTGATTATTTATAATAAGATTCA
AACATATTATAACATGGCGGTAATAGTAGATATTTACAATAATCATCATAAGGCTCTAAA
TAAAATGTTGATTTAGCTAATTACCTTTAATAATAATATTCGGCAGAAATCACAATCGGA
AAGGGTAAAAAAACTTTATAAGTCCTTGTTGATACTGGCTCAAGTAAGCTCATGCTACCG
AGCAAGAACTGCATCGATAATAAAAATTGCAAGGGCTTCAATGCGTATTATGATTGTTTA
TCCTCAGATGGCTGCAATACCACAAATATAGAGTATACTTAAAACTACTTGACTGGATAA
GTGAATGGTGTCAATGTGAATGCAACAGTAGGAATAGCTAATTTATCTCAAATCTAACAA
TCTGTACTCTTGTTTGATGAATCTAATAAATTTACCAATGAATTCTCTGATGGCTTATTA
GGATTGTCAGTTTATAATAAAGATAACAATGGAAGCAATTCTTTCGTTACTAATCTCTAT
AAAAATGGTGTGATTCAAGAAAATATGTTCTCTTTGTATCTAGGATACAAATTGGATGAC
TCAGAACTTGTTTTGGGAGGTTATAACTCTAAAAAGATAGATCCGTCTTCTAAAATTTAT
AACCATAAGATATTATAAAATTTACAATATGACGATTCGTAGAAATGGGTTATTCCAGTA
TAAAGAATTGAATTAAATACTTTTTCCAAAACACTTTCTTCATAAAATAACCTGGCGATT
ATTGACTCTTCCTATCCTTATCTGGGAGTAGAACAAAGTATGTATTAAGGTATGGTAGAC
TATTTTGTTAAGAAAGGAGCTAAGCTAATAAACAATAAATATCAAATCGAATGCAACAAA
ACTCTTGATGATATATAATTCACTATCACGGATTCTGATTAAGTAGGAAGGATTTATTCT
CTTCCTTTTTCATTTTACACTTCAAACTCATCAAATACATGCACTTTTTTAATTTAATCT
TATAACGGAGCAAGTAATGTAGGTTTTGTGCTTGGAAATGCATTTCTAAGAAGATATGTT
TCAATCTTCTACTACTCAAATTTAACAGTTAGTTTTGGATAATCAACCGCAAACCCAAAT
GATGATTACACAAGTGGCTTACCCACATGGGCTATAGCTGTAATAGCTGCTGCTGCATCT
CTGTTTTCATTAGCAGGAGGATTTGCCTTATATAAAAAATGCAAAGGAAATAAAAATAGA
AGTGGCCTTACTTAAACTATGGTTAGCAATACATCTATTTGA


>TTHERM_00678540(protein)
MIIKQIVTFALLLILSKAEIIKIQLKKQTITQLDYLQQDSNILQHGGNSRYLQQSSQGSK
QNVDLANYLQQQYSAEITIGKGKKTLQVLVDTGSSKLMLPSKNCIDNKNCKGFNAYYDCL
SSDGCNTTNIEYTQNYLTGQVNGVNVNATVGIANLSQIQQSVLLFDESNKFTNEFSDGLL
GLSVYNKDNNGSNSFVTNLYKNGVIQENMFSLYLGYKLDDSELVLGGYNSKKIDPSSKIY
NHKILQNLQYDDSQKWVIPVQRIELNTFSKTLSSQNNLAIIDSSYPYLGVEQSMYQGMVD
YFVKKGAKLINNKYQIECNKTLDDIQFTITDSDQVGRIYSLPFSFYTSNSSNTCTFLIQS
YNGASNVGFVLGNAFLRRYVSIFYYSNLTVSFGQSTANPNDDYTSGLPTWAIAVIAAAAS
LFSLAGGFALYKKCKGNKNRSGLTQTMVSNTSI


>TTHERM_00678540(gene)
ATGATAATTAAACAAATAGTAACCTTTGCTTTGCTTTTAATACTAAGCAAGGCGGAAATC
ATAAAAATTCAACTCAAAAAATAGACAATAACCTAACTTGATTATTTATAATAAGATTCA
AACATATTATAACATGGCGGTAATAGTAGATATTTACAATAATCATCATAAGGCTCTAAA
TAAAATGTTGATTTAGCTAATTACCTTTAATAATAATATTCGGCAGAAATCACAATCGGA
AAGGGTAAAAAAACTTTATAAGTCCTTGTTGATACTGGCTCAAGTAAGCTCATGCTACCG
AGCAAGAACTGCATCGATAATAAAAATTGCAAGGTAAAATAACAAAATAGAATTTTATTT
AGATGATAATTTTTTATAAACTAAGGGCTTCAATGCGTATTATGATTGTTTATCCTCAGA
TGGCTGCAATACCACAAATATAGAGTATACTTAAAACTACTTGACTGGATAAGTGAATGG
TGTCAATGTGAATGCAACAGTAGGAATAGCTAATTTATCTCAAATCTAACAATCTGTACT
CTTGTTTGATGAATCTAATAAATTTACCAATGAATTCGTATTAACAATTAATTATCTTTC
CTTTAATTAGAAAAAAAAGCATGTTATATAAATTTAATTTAATTTTTAATTTTTTAGTAT
TTGAAGATGCTTTTTCTGATATTTTATGATTATTGAAATTCTTATTTTAATTTTATTTAA
CATAGTCTGATGGCTTATTAGGATTGTCAGTTTATAATAAAGATAACAATGGAAGCAATT
CTTTCGTTACTAATCTCTATAAAAATGGTGTGATTCAAGAAAATATGTTCTCTTTGTATC
TAGGATACAAATTGGATGACTCAGAACTTGTTTTGGGAGGTTATAACTCTAAAAAGATAG
ATCCGTCTTCTAAAATTTATAACCATAAGATATTATAAAATTTACAATATGACGATTCGT
AGAAATGGGTTATTCCAGTATAAAGAATTGAATTAAATACTTTTTCCAAAACACTTTCTT
CATAAAATAACCTGGCGATTATTGACTCTTCCTATCCTTATCTGGGAGTAGAACAAAGTA
TGTATTAAGGTATGGTAGACTATTTTGTTAAGAAAGGAGCTAAGCTAATAAACAATAAAT
ATCAAATCGAATGCAACAAAACTCTTGATGATATATAATTCACTATCACGGATTCTGATT
AAGTAGGAAGGATTTATTCTCTTCCTTTTTCATTTTACACTTCAAACTCATCAAATACAT
GCACTTTTTTAATTTAATCTTATAACGGAGCAAGTAATGTAGGTTTTGTGCTTGGAAATG
CATTTCTAAGAAGATATGTTTCAATCTTCTACTACTCAAATTTAACAGTTAGTAACCTTA
AAAAATTTTAGTCTAATTAACATTAAAAAATTTCATCTTAAATTAATAGGTTTTGGATAA
TCAACCGCAAACCCAAATGATGATTACACAAGTGGCTTACCCACATGGGCTATAGCTGTA
ATAGCTGCTGCTGCATCTCTGTTTTCATTAGCAGGAGGATTTGCCTTATATAAAAAATGC
AAAGGAAATAAAAATAGAAGTGGCCTTACTTAAACTATGGTTAGCAATACATCTATTTGA