Identifiers and Description

Gene Model Identifier

TTHERM_01053050

Standard Name

CTH24 (CaTHepsin 24)

Aliases

PreTt22028 | 213.m00078

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 61.3%

TetraMine Data

TTHERM_01053050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09420.19.99530525570754e-113eukaryotic aspartyl protease (
346 aa)
SGDYPL154C1.0000422327488734e-24PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
WormBaseWBGene000191041.999790113608142e-24locus:asp-7 status:Partially
_confirmed UniProt:O16339
protein_id:CCD67829.1
DictyBaseDDB_G02794117.997402223525235e-19ctsD on chromosome: 3 position
2104523 to 2105867
OxytrichaContig18588.0.g1102.999758165421992e-18Eukaryotic aspartyl protease
Stentor CoeruleusSteCoe_295290.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01053050(coding)
ATGACTTCGGTTTCTGTAAAAATACTTTTCGTCTTTCTTGCTCTAGCTGCTGTTGGCTAA
TGCATTATTAGTCTTCCTTTAAAATAAGGACAAATCTCTAGAGCTGCACAACCTTATACC
AGAAAATCTTATTTGAGAAGTACTCTTACCAATAAGCTAGTTAACTTCTTAGACGATATT
TATATTGCTGAAGTTTAGGTTGGTAAATCTAAATAGAATTTCAAAGTTGTTTTTGATACT
GGAAGCGAGCTTTTCTGGATCCCTTCTGCAGAATGCGATACCTGCAAAAAAGCTGATATG
AAAACTTATAGTTGCACTGAAGAAGATGAATGCACTCCTAGTGAGTATTATGGGGAATTG
CAATACGCAACTGGATACGCTGCTGGTAATATTACTCATTTCAATATTGGCATTCCTGGA
ACAGAAAATGTTGAATATTTTGGATTGCTAATTAACACAGTTTCTTATCTTCCTTCAGGA
TTCGATGGTATTATCGGCTTGTCTCCTATTTGCAAAGTCGCTGAAGGATCAACCTAACCC
AACTTGATTCCTTAATTATATGAAAATAAATAAATTGAAAAACCTATTGTCTCTTTCTAC
TAAGCCTTTAGTGCTGATGAAAAAGCTGGAAAAGTATAATCTGCTATTACTTTTGGAGGT
TACGATGAATCCAAAGTTGTTGGCAAAATATAATATTTCAAAACTGTCAAATAAAGCGCT
TGGTATGTACCTTTTGAAGAATTTGAAGTTGATGGCGTTAAAGTTTACACTGAAAAGGGT
TCTGCTTTAATTGATACTGGTACCACTTCATTCTATTTGAGACCTGATATTGCTGAAAAA
TATTTTGATAACATTTAACTGAAGAGAGGAATTAAAATTGGAGATGAGTATGATGTCCCA
TGTGATTCTGATTTTCCCAGCATTTCATTCTCTTTACGTAATGTTGATGGAGAATTAATT
AAATTCGAAATTGAACCTTCTTTCTATGTCACTCCTTCTCTCACCAAAAAGAATGTTTGT
TACTTGTACTTTGAAGGTTTAATTGGCAATGGACCTCAAATGGTTATCGGAAATACTGTT
CTAAGAAAGTATCTCCCTATTTTTGATTATGAAAATAATACTATCGGCCTTGGTCGCACA
ATTAACTAACCACCAAGAACTTACCATTCCAAATCAGAATAATGA


>TTHERM_01053050(protein)
MTSVSVKILFVFLALAAVGQCIISLPLKQGQISRAAQPYTRKSYLRSTLTNKLVNFLDDI
YIAEVQVGKSKQNFKVVFDTGSELFWIPSAECDTCKKADMKTYSCTEEDECTPSEYYGEL
QYATGYAAGNITHFNIGIPGTENVEYFGLLINTVSYLPSGFDGIIGLSPICKVAEGSTQP
NLIPQLYENKQIEKPIVSFYQAFSADEKAGKVQSAITFGGYDESKVVGKIQYFKTVKQSA
WYVPFEEFEVDGVKVYTEKGSALIDTGTTSFYLRPDIAEKYFDNIQLKRGIKIGDEYDVP
CDSDFPSISFSLRNVDGELIKFEIEPSFYVTPSLTKKNVCYLYFEGLIGNGPQMVIGNTV
LRKYLPIFDYENNTIGLGRTINQPPRTYHSKSEQ


>TTHERM_01053050(gene)
ATGACTTCGGTTTCTGTAAAAATACTTTTCGTCTTTCTTGCTCTAGCTGCTGTTGGCTAA
TGCATTATTAGTCTTCCTTTAAAATAAGGACAAATCTCTAGAGCTGCACAACCTTATACC
AGAAAATCTTATTTGAGAAGTACTCTTACCAATAAGCTAGTTAACTTCTTAGACGATATT
TATATTGCTGAAGTTTAGGTTGGTAAATCTAAATAGAATTTCAAAGTTGTTTTTGATACT
GGAAGCGAGCTTTTCTGGATCCCTTCTGCAGAATGCGATACCTGCAAAAAAGCTGATATG
AAAACTTATAGTTGCACTGAAGAAGATGAATGCACTCCTAGTGAGTATTATGGGGAATTG
CAATACGCAACTGGATACGCTGCTGGTAATATTACTCATTTCAATATTGGCATTCCTGGA
ACAGAAAATGTTGAATATTTTGGATTGCTAATTAACACAGTTTCTTATCTTCCTTCAGGA
TTCGATGGTATTATCGGCTTGTCTCCTATTTGCAAAGTCGCTGAAGGATCAACCTAACCC
AACTTGATTCCTTAATTATATGAAAATAAATAAATTGAAAAACCTATTGTCTCTTTCTAC
TAAGCCTTTAGTGCTGATGAAAAAGCTGGAAAAGTATAATCTGCTATTACTTTTGGAGGT
TACGATGAATCCAAAGTTGTTGGCAAAATATAATATTTCAAAACTGTCAAATAAAGCGCT
TGGTATGTACCTTTTGAAGAATTTGAAGTTGATGGCGTTAAAGTTTACACTGAAAAGGGT
TCTGCTTTAATTGATACTGGTACCACTTCATTCTATTTGAGACCTGATATTGCTGAAAAA
TATTTTGATAACATTTAACTGAAGAGAGGAATTAAAATTGGAGATGAGTATGATGTCCCA
TGTGATTCTGATTTTCCCAGCATTTCATTCTCTTTACGTAATGTTGATGGAGAATTAATT
AAATTCGAAATTGAACCTTCTTTCTATGTCACTCCTTCTCTCACCAAAAAGAATGTTTGT
TACTTGTACTTTGAAGGTTTAATTGGCAATGGACCTCAAATGGTTATCGGAAATACTGTT
CTAAGAAAGTATCTCCCTATTTTTGATTATGAAAATAATACTATCGGCCTTGGTCGCACA
ATTAACTAACCACCAAGAACTTACCATTCCAAATCAGAATAATGA