Identifiers and Description

Gene Model Identifier

TTHERM_00433600

Standard Name

CTH21 (CaTHepsin 21)

Aliases

PreTt26502 | 48.m00265 | 3831.m01601

Description

CTH21 eukaryotic aspartyl protease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 59.9%

TetraMine Data

TTHERM_00433600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04199.19.997093137033517e-262eukaryotic aspartyl protease (
502 aa)
OxytrichaContig3196.0.g1052.998863950472602e-38Eukaryotic aspartyl protease
Stentor CoeruleusSteCoe_295290.000000000000012664165549094176
WormBaseWBGene000002160.00000000000004998767099442072locus:asp-3 Aspartic proteas
e 3 status:Confirmed UniPr
ot:P55956 protein_id:CCD7241
5.2
DictyBaseDDB_G02775810.00000000000040012475857291343DDB_G0277581 on chromosome: 2
position 8272981 to 8274558
SGDYPL154C0.000000000800327577657144PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433600(coding)
ATGAAAAGCACTTATACAAATAGTATTATTAAAATAATATTAACAGTACTTATTTTTACT
CAAAGCACGGTCGTTGCTAAAGGAAATTTAATAGAGTTGGATCTTATAAAGCAATAAGTA
AATGGATAATAGCTATATAATCGATTATAAAGGGAATTTAGTAATCCATAAAAGGTTAAA
TAAGAATAAGATAAAATCATAAAGCAGATAAACCATAAACACTATAATGATAAATAAAAT
GAACTAAATTCATTTTAAAATTCTACAGAAAATTAGAGTGCAGATTAAACATAAATTCCA
GAGCTGCTACTGAGAAATATTTAAAATAATTAATATATTGTCAATTTATATATTGGATCT
CAATCAGTTAAGTAACCATTATTGATTGACACAGGTAGTCCATATACTCTAGTCGATGGC
GTTGACTGTGAGAAATGTCATATTTAAAATTCTAAAAACTCTCTTTTTGATTGCAATTAA
TCACCTACTTGCAAATTAACTGATAAATCTTCCTATGAGCTTACATTTGTACAAGGAAAA
GCTCAAGGTTTGTAGGTTAAAGATAGAGTTTGCTTATAAAGTGGATTAGCTCAGTGCACT
TCTAATGAGTTTACTTTCATAGATATATATAATATTACTTATTCAATGGAAAATATTGAA
GCAGATGGAATATTAGGATTGGGGATGATAAAAAAGAATCCTAATTTTTCTTTTGTTTAA
CAGCTGTTTGCAAGTGGACAAATTTCTGAACCTTCATTTTCTCTTTACATTAACGATATT
AGCTTCGATATGAGGTACTAGAAGGATATTTCTAAACTTATTTTGGGAGGTGTTAACATG
AAATATGGAGTTGAAAATTAGGTTATGGTTTATCACAGTATTGCAAATTCTGATAGTTGG
GCATTAAACTTAGACACAGTGAAATTCAATGATAAAAATATAAAATAGAAGGATTCTAAG
ATAGCAATAATTGACTCTGGATCATCCAATATTGTTCTTCCAAGAGAGGACTATAATTAT
TTATTGAAGTATTTAACAAACGATCTTCATTTCATTTGTCAACCATAAAACAATATATAC
CTTTAATGTTCATGTCCAACTGGAGAGATTGGAGTCTTTCCAGAGGTAAAGATTAAGTTT
GCAGGAGTTGATTAAATATATGTATTAAGTCCAAAGGATTACATCATACAAGAAAACCAC
CTTTGTAATATGCAAATAAGCTACTACTCTTCAACTGATGGTTCTTGGATCTTAGGTGAT
GTTTTTTTGAGAAAGTACATGTCCTATTTCAATATTTAAAAAGAATAAATTGGACTCATT
CTCTCCAACAAAAAAAGTCTTGAAAGTAGAGAATTTCTTAAGGATGTTATGCTCATTTTA
GAGTGTATCTTAGGCTCTCTTTTCTTGGGTATCTTAGTCATTTATTTCATCCGCATGATT
AGTGGTTTAAAGAATGCTAAGGATGAAGAACTTAATTTTGATTGA


>TTHERM_00433600(protein)
MKSTYTNSIIKIILTVLIFTQSTVVAKGNLIELDLIKQQVNGQQLYNRLQREFSNPQKVK
QEQDKIIKQINHKHYNDKQNELNSFQNSTENQSADQTQIPELLLRNIQNNQYIVNLYIGS
QSVKQPLLIDTGSPYTLVDGVDCEKCHIQNSKNSLFDCNQSPTCKLTDKSSYELTFVQGK
AQGLQVKDRVCLQSGLAQCTSNEFTFIDIYNITYSMENIEADGILGLGMIKKNPNFSFVQ
QLFASGQISEPSFSLYINDISFDMRYQKDISKLILGGVNMKYGVENQVMVYHSIANSDSW
ALNLDTVKFNDKNIKQKDSKIAIIDSGSSNIVLPREDYNYLLKYLTNDLHFICQPQNNIY
LQCSCPTGEIGVFPEVKIKFAGVDQIYVLSPKDYIIQENHLCNMQISYYSSTDGSWILGD
VFLRKYMSYFNIQKEQIGLILSNKKSLESREFLKDVMLILECILGSLFLGILVIYFIRMI
SGLKNAKDEELNFD


>TTHERM_00433600(gene)
ATGAAAAGCACTTATACAAATAGTATTATTAAAATAATATTAACAGTACTTATTTTTACT
CAAAGCACGGTCGTTGCTAAAGGAAATTTAATAGAGTTGGATCTTATAAAGCAATAAGTA
AATGGATAATAGCTATATAATCGATTATAAAGGGAATTTAGTAATCCATAAAAGGTTAAA
TAAGAATAAGATAAAATCATAAAGCAGATAAACCATAAACACTATAATGATAAATAAAAT
GAACTAAATTCATTTTAAAATTCTACAGAAAATTAGAGTGCAGATTAAACATAAATTCCA
GAGCTGCTACTGAGAAATATTTAAAATAATTAATATATTGTCAATTTATATATTGGATCT
CAATCAGTTAAGTAACCATTATTGATTGACACAGGTAGTCCATATACTCTAGTCGATGGC
GTTGACTGTGAGAAATGTCATATTTAAAATTCTAAAAACTCTCTTTTTGATTGCAATTAA
TCACCTACTTGCAAATTAACTGATAAATCTTCCTATGAGCTTACATTTGTACAAGGAAAA
GCTCAAGGTTTGTAGGTAATAAGATTTAAATAAATTTTATTTTTAATCTATAAAAAACAA
AAAGCTTAAATTTAAATAAAAATGTTCTAAAAAGCAACTGGAAATAATGAAGAATATTAT
AAGGTCATACATACATTCATAAACAATATCTCAATAAATAAACATATCATTCTTTATTTT
TATATAACTTAATAAATAAATCATATCTTAATATAAAATAAATTATTCATTTATGAAATG
TTTATTTTAAGTAGATATAATATTATTAAGCTTGAAACCAAAAAGCAAGCAACAAATAAT
TTATCAATCAAGGAAAAAAAAACAAACAAATAAATAAAGGAAATAAGCAATAAATCAAAC
AAATTAATAAATATAAATAGGCAATAAACAAACAAGCAACCTTTTTAGCAAACAAGCAAA
TAAAAGTTATAAAAATAATTTAAAACTTACAAAATTAGCTTAAACACAAAGTAAAATTGT
TTTGAAGATGTCAAATGAGTTTTGAGCTTTATGTTAAGAATTAAAGAACAGTAAATATGT
TTCTATCATAAATTTAAAGTTATATTTTAAGAGTTTAAATCTTTTATAAATTTCGAAAAT
TGAAGAGGAATTTATTTCGATTGAAAAGACCAGTCAAAATTTCAAAAAAAAATTATAAAA
TTTTAGCAAATAAATATCCATTTTTTAATTAATAATTTGTAAGGGATTAACAATTTCCAT
AAAATAATATTTTTAAGCAAATAAATAAGGTTTTTTTAATAATTTATTTAGCATTTTTCT
TTAAGTTAAAATTAATAAAAAAAAAGGAGTTTTAAAATTATTTTTAGCAATAAGCTTTTT
AAATTGAATTGAATTTATTTATTTATTTGAAACATTTTATTTAATAAAAAGTTTAATTAA
AGTTTTAATTTTTTGATAATAGGTTAAAGATAGAGTTTGCTTATAAAGTGGATTAGCTCA
GTGCACTTCTAATGAGTTTACTTTCATAGATATATATAATATTACTTATTCAATGGAAAA
TATTGAAGCAGATGGAATATTAGGATTGGGGATGATAAAAAAGAATCCTAATTTTTCTTT
TGTTTAACAGCTGTTTGCAAGTGGACAAATTTCTGAACCTTCATTTTCTCTTTACATTAA
CGATATTAGCTTCGATATGAGGTACTAGAAGGATATTTCTAAACTTATTTTGGGAGGTGT
TAACATGAAATATGGAGTTGAAAATTAGGTTATGGTTTATCACAGTATTGCAAATTCTGA
TAGTTGGGCATTAAACTTAGACACAGTGAAATTCAATGATAAAAATATAAAATAGAAGGA
TTCTAAGATAGCAATAATTGACTCTGGATCATCCAATATTGTTCTTCCAAGAGAGGACTA
TAATTATTTATTGAAGTATTTAACAAACGATCTTCATTTCATTTGTCAACCATAAAACAA
TATATACCTTTAATGTTCATGTCCAACTGGAGAGATTGGAGTCTTTCCAGAGGTAAAGAT
TAAGTTTGCAGGAGTTGATTAAATATATGTATTAAGTCCAAAGGATTACATCATACAAGA
AAACCACCTTTGTAATATGCAAATAAGCTACTACTCTTCAACTGATGGTTCTTGGATCTT
AGGTGATGTTTTTTTGAGAAAGTACATGTCCTATTTCAATATTTAAAAAGAATAAATTGG
ACTCATTCTCTCCAACAAAAAAAGTCTTGAAAGTAGAGAATTTCTTAAGGATGTTATGCT
CATTTTAGAGTGTATCTTAGGCTCTCTTTTCTTGGGTATCTTAGTCATTTATTTCATCCG
CATGATTAGTGGTTTAAAGAATGCTAAGGATGAAGAACTTAATTTTGATTGA