Identifiers and Description

Gene Model Identifier

TTHERM_00433600

Standard Name

CTH21 (cathepsin 21)

Aliases

PreTt26502 | 48.m00265 | 3831.m01601

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 59.9%

TetraMine Data

TTHERM_00433600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04199.19.997093137033517e-262eukaryotic aspartyl protease (
502 aa)
OxytrichaContig3196.0.g1052.998863950472602e-38Eukaryotic aspartyl protease
Stentor CoeruleusSteCoe_295290.000000000000012664165549094176
WormBaseWBGene000002160.00000000000004998767099442072locus:asp-3 Aspartic proteas
e 3 status:Confirmed UniPr
ot:P55956 protein_id:CCD7241
5.2
DictyBaseDDB_G02775810.00000000000040012475857291343DDB_G0277581 on chromosome: 2
position 8272981 to 8274558
SGDYPL154C0.000000000800327577657144PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433600(coding)
ATGAAAAGCACTTATACAAATAGTATTATTAAAATAATATTAACAGTACTTATTTTTACT
CAAAGCACGGTCGTTGCTAAAGGAAATTTAATAGAGTTGGATCTTATAAAGCAATAAGTA
AATGGATAATAGCTATATAATCGATTATAAAGGGAATTTAGTAATCCATAAAAGGTTAAA
TAAGAATAAGATAAAATCATAAAGCAGATAAACCATAAACACTATAATGATAAATAAAAT
GAACTAAATTCATTTTAAAATTCTACAGAAAATTAGAGTGCAGATTAAACATAAATTCCA
GAGCTGCTACTGAGAAATATTTAAAATAATTAATATATTGTCAATTTATATATTGGATCT
CAATCAGTTAAGTAACCATTATTGATTGACACAGGTAGTCCATATACTCTAGTCGATGGC
GTTGACTGTGAGAAATGTCATATTTAAAATTCTAAAAACTCTCTTTTTGATTGCAATTAA
TCACCTACTTGCAAATTAACTGATAAATCTTCCTATGAGCTTACATTTGTACAAGGAAAA
GCTCAAGGTTTGTAGGTTAAAGATAGAGTTTGCTTATAAAGTGGATTAGCTCAGTGCACT
TCTAATGAGTTTACTTTCATAGATATATATAATATTACTTATTCAATGGAAAATATTGAA
GCAGATGGAATATTAGGATTGGGGATGATAAAAAAGAATCCTAATTTTTCTTTTGTTTAA
CAGCTGTTTGCAAGTGGACAAATTTCTGAACCTTCATTTTCTCTTTACATTAACGATATT
AGCTTCGATATGAGGTACTAGAAGGATATTTCTAAACTTATTTTGGGAGGTGTTAACATG
AAATATGGAGTTGAAAATTAGGTTATGGTTTATCACAGTATTGCAAATTCTGATAGTTGG
GCATTAAACTTAGACACAGTGAAATTCAATGATAAAAATATAAAATAGAAGGATTCTAAG
ATAGCAATAATTGACTCTGGATCATCCAATATTGTTCTTCCAAGAGAGGACTATAATTAT
TTATTGAAGTATTTAACAAACGATCTTCATTTCATTTGTCAACCATAAAACAATATATAC
CTTTAATGTTCATGTCCAACTGGAGAGATTGGAGTCTTTCCAGAGGTAAAGATTAAGTTT
GCAGGAGTTGATTAAATATATGTATTAAGTCCAAAGGATTACATCATACAAGAAAACCAC
CTTTGTAATATGCAAATAAGCTACTACTCTTCAACTGATGGTTCTTGGATCTTAGGTGAT
GTTTTTTTGAGAAAGTACATGTCCTATTTCAATATTTAAAAAGAATAAATTGGACTCATT
CTCTCCAACAAAAAAAGTCTTGAAAGTAGAGAATTTCTTAAGGATGTTATGCTCATTTTA
GAGTGTATCTTAGGCTCTCTTTTCTTGGGTATCTTAGTCATTTATTTCATCCGCATGATT
AGTGGTTTAAAGAATGCTAAGGATGAAGAACTTAATTTTGATTGA


>TTHERM_00433600(protein)
MKSTYTNSIIKIILTVLIFTQSTVVAKGNLIELDLIKQQVNGQQLYNRLQREFSNPQKVK
QEQDKIIKQINHKHYNDKQNELNSFQNSTENQSADQTQIPELLLRNIQNNQYIVNLYIGS
QSVKQPLLIDTGSPYTLVDGVDCEKCHIQNSKNSLFDCNQSPTCKLTDKSSYELTFVQGK
AQGLQVKDRVCLQSGLAQCTSNEFTFIDIYNITYSMENIEADGILGLGMIKKNPNFSFVQ
QLFASGQISEPSFSLYINDISFDMRYQKDISKLILGGVNMKYGVENQVMVYHSIANSDSW
ALNLDTVKFNDKNIKQKDSKIAIIDSGSSNIVLPREDYNYLLKYLTNDLHFICQPQNNIY
LQCSCPTGEIGVFPEVKIKFAGVDQIYVLSPKDYIIQENHLCNMQISYYSSTDGSWILGD
VFLRKYMSYFNIQKEQIGLILSNKKSLESREFLKDVMLILECILGSLFLGILVIYFIRMI
SGLKNAKDEELNFD


>TTHERM_00433600(gene)
ATGAAAAGCACTTATACAAATAGTATTATTAAAATAATATTAACAGTACTTATTTTTACT
CAAAGCACGGTCGTTGCTAAAGGAAATTTAATAGAGTTGGATCTTATAAAGCAATAAGTA
AATGGATAATAGCTATATAATCGATTATAAAGGGAATTTAGTAATCCATAAAAGGTTAAA
TAAGAATAAGATAAAATCATAAAGCAGATAAACCATAAACACTATAATGATAAATAAAAT
GAACTAAATTCATTTTAAAATTCTACAGAAAATTAGAGTGCAGATTAAACATAAATTCCA
GAGCTGCTACTGAGAAATATTTAAAATAATTAATATATTGTCAATTTATATATTGGATCT
CAATCAGTTAAGTAACCATTATTGATTGACACAGGTAGTCCATATACTCTAGTCGATGGC
GTTGACTGTGAGAAATGTCATATTTAAAATTCTAAAAACTCTCTTTTTGATTGCAATTAA
TCACCTACTTGCAAATTAACTGATAAATCTTCCTATGAGCTTACATTTGTACAAGGAAAA
GCTCAAGGTTTGTAGGTAATAAGATTTAAATAAATTTTATTTTTAATCTATAAAAAACAA
AAAGCTTAAATTTAAATAAAAATGTTCTAAAAAGCAACTGGAAATAATGAAGAATATTAT
AAGGTCATACATACATTCATAAACAATATCTCAATAAATAAACATATCATTCTTTATTTT
TATATAACTTAATAAATAAATCATATCTTAATATAAAATAAATTATTCATTTATGAAATG
TTTATTTTAAGTAGATATAATATTATTAAGCTTGAAACCAAAAAGCAAGCAACAAATAAT
TTATCAATCAAGGAAAAAAAAACAAACAAATAAATAAAGGAAATAAGCAATAAATCAAAC
AAATTAATAAATATAAATAGGCAATAAACAAACAAGCAACCTTTTTAGCAAACAAGCAAA
TAAAAGTTATAAAAATAATTTAAAACTTACAAAATTAGCTTAAACACAAAGTAAAATTGT
TTTGAAGATGTCAAATGAGTTTTGAGCTTTATGTTAAGAATTAAAGAACAGTAAATATGT
TTCTATCATAAATTTAAAGTTATATTTTAAGAGTTTAAATCTTTTATAAATTTCGAAAAT
TGAAGAGGAATTTATTTCGATTGAAAAGACCAGTCAAAATTTCAAAAAAAAATTATAAAA
TTTTAGCAAATAAATATCCATTTTTTAATTAATAATTTGTAAGGGATTAACAATTTCCAT
AAAATAATATTTTTAAGCAAATAAATAAGGTTTTTTTAATAATTTATTTAGCATTTTTCT
TTAAGTTAAAATTAATAAAAAAAAAGGAGTTTTAAAATTATTTTTAGCAATAAGCTTTTT
AAATTGAATTGAATTTATTTATTTATTTGAAACATTTTATTTAATAAAAAGTTTAATTAA
AGTTTTAATTTTTTGATAATAGGTTAAAGATAGAGTTTGCTTATAAAGTGGATTAGCTCA
GTGCACTTCTAATGAGTTTACTTTCATAGATATATATAATATTACTTATTCAATGGAAAA
TATTGAAGCAGATGGAATATTAGGATTGGGGATGATAAAAAAGAATCCTAATTTTTCTTT
TGTTTAACAGCTGTTTGCAAGTGGACAAATTTCTGAACCTTCATTTTCTCTTTACATTAA
CGATATTAGCTTCGATATGAGGTACTAGAAGGATATTTCTAAACTTATTTTGGGAGGTGT
TAACATGAAATATGGAGTTGAAAATTAGGTTATGGTTTATCACAGTATTGCAAATTCTGA
TAGTTGGGCATTAAACTTAGACACAGTGAAATTCAATGATAAAAATATAAAATAGAAGGA
TTCTAAGATAGCAATAATTGACTCTGGATCATCCAATATTGTTCTTCCAAGAGAGGACTA
TAATTATTTATTGAAGTATTTAACAAACGATCTTCATTTCATTTGTCAACCATAAAACAA
TATATACCTTTAATGTTCATGTCCAACTGGAGAGATTGGAGTCTTTCCAGAGGTAAAGAT
TAAGTTTGCAGGAGTTGATTAAATATATGTATTAAGTCCAAAGGATTACATCATACAAGA
AAACCACCTTTGTAATATGCAAATAAGCTACTACTCTTCAACTGATGGTTCTTGGATCTT
AGGTGATGTTTTTTTGAGAAAGTACATGTCCTATTTCAATATTTAAAAAGAATAAATTGG
ACTCATTCTCTCCAACAAAAAAAGTCTTGAAAGTAGAGAATTTCTTAAGGATGTTATGCT
CATTTTAGAGTGTATCTTAGGCTCTCTTTTCTTGGGTATCTTAGTCATTTATTTCATCCG
CATGATTAGTGGTTTAAAGAATGCTAAGGATGAAGAACTTAATTTTGATTGA