Identifiers and Description

Gene Model Identifier

TTHERM_01053070

Standard Name

CTH20 (cathepsin 20)

Aliases

PreTt22030 | 213.m00080

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01053070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09420.15.999393432078778e-90eukaryotic aspartyl protease (
346 aa)
WormBaseWBGene000191044.0013320766793207e-25locus:asp-7 status:Partially
_confirmed UniProt:O16339
protein_id:CCD67829.1
SGDYPL154C1.9994498063102785e-22PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
DictyBaseDDB_G02794119.99946582325553e-18ctsD on chromosome: 3 position
2104523 to 2105867
OxytrichaContig19103.0.g520.000000000000006999063783600386Eukaryotic aspartyl protease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01053070(coding)
ATGAATAAAAGTTTGATGAAATCCTTCTTAGTGATTTTTGCTTTTGCTGCCCTTGGCCAA
TGCTTGCTAAGTATCCCCTTAAAAAAAAGTATACCATTTAGGTAAACTTTTGATACTTCC
TCGAACTCTCACTTGAGAAAAAATGTTGTAAACAATCTTGTCAACTATTAAGATGGTATT
TATTATGCTGAAGTAAAAATTGGAAAATCATAATAACCACTCTAAGTCATATTTGATAGT
AGTAGTAGTGAATTTTGGATAGCCTCCAGCAAGTGTCAATCTTGTGTTATAGCTTAAATG
TAAACTTATGACTGCAAAGTGGAAGATTTATGCATTACTTAAGAAGAATAATTGGTATAT
TAATTCGAAACAGGATTTATCACTGGTAATTTAGCTAAGTTTTATCTAGGAGTACCTGAA
ACAAATTCAATTGATTACTTTGGAGTTTTAATTAACGAAGTTGAAAGAATTCCTTCTAGA
ATTAACGGAGTCTTTGGTTTAATTCCTTCTGACAACTTAACAGATACTTTGACTCAACCT
AACTTAGTCCTTTAGTTGCATTAAACTCAACAAATAGAAAAGCCATTATTATCTTTCTAC
TTTGCTTTGGAGTAGGATGAAAAAGCTGGTAAATAGAACTCTTCAGTTACTTTTGGAGGT
TACGATGACTCTAAAATAGTAGGACAAATTGAGTATTTCAAGACTGTTTAACAAAATACT
TGGTTTGTAGAGTTCAATGACTTCGAAGTTGATGGAGTTAATGTATTTTCCCAAGTAAAC
TATGCTTTAATTGATACTAGCTCTCCCTTATTTTAATTCAATCCTAATATCGCAGAAAAA
TTCTAAGCAATACTAGCTTAGAGAGGAATTTACATTGGTTCAGACAACCAAATTCCCTGC
AATTCTGATCTTCCTACTATAGCTTTTACATTGCGTAATACCTAAGGAAATCTTGTGAAA
TTTGAAGTTGAACCTTCTTTCTACTTGATTTAGTCATCAAATTTATCAAATGTTTGCTAT
TTATACGTATATGGTGATTGCTAAGGTCCTGCTTTAGTTGTAGGAAGTCAATTCATTAAA
AAATATTTGACTATCTTTGATTATGAGCAAAAAACAATTGGTTTAGCTCGTTCTATTAAC
AACCCCCAATAGTCTACCTTGTAAAATTGA


>TTHERM_01053070(protein)
MNKSLMKSFLVIFAFAALGQCLLSIPLKKSIPFRQTFDTSSNSHLRKNVVNNLVNYQDGI
YYAEVKIGKSQQPLQVIFDSSSSEFWIASSKCQSCVIAQMQTYDCKVEDLCITQEEQLVY
QFETGFITGNLAKFYLGVPETNSIDYFGVLINEVERIPSRINGVFGLIPSDNLTDTLTQP
NLVLQLHQTQQIEKPLLSFYFALEQDEKAGKQNSSVTFGGYDDSKIVGQIEYFKTVQQNT
WFVEFNDFEVDGVNVFSQVNYALIDTSSPLFQFNPNIAEKFQAILAQRGIYIGSDNQIPC
NSDLPTIAFTLRNTQGNLVKFEVEPSFYLIQSSNLSNVCYLYVYGDCQGPALVVGSQFIK
KYLTIFDYEQKTIGLARSINNPQQSTLQN


>TTHERM_01053070(gene)
ATGAATAAAAGTTTGATGAAATCCTTCTTAGTGATTTTTGCTTTTGCTGCCCTTGGCCAA
TGCTTGCTAAGTATCCCCTTAAAAAAAAGTATACCATTTAGGTAAACTTTTGATACTTCC
TCGAACTCTCACTTGAGAAAAAATGTTGTAAACAATCTTGTCAACTATTAAGATGGTATT
TATTATGCTGAAGTAAAAATTGGAAAATCATAATAACCACTCTAAGTCATATTTGATAGT
AGTAGTAGTGAATTTTGGATAGCCTCCAGCAAGTGTCAATCTTGTGTTATAGCTTAAATG
TAAACTTATGACTGCAAAGTGGAAGATTTATGCATTACTTAAGAAGAATAATTGGTATAT
TAATTCGAAACAGGATTTATCACTGGTAATTTAGCTAAGTTTTATCTAGGAGTACCTGAA
ACAAATTCAATTGATTACTTTGGAGTTTTAATTAACGAAGTTGAAAGAATTCCTTCTAGA
ATTAACGGAGTCTTTGGTTTAATTCCTTCTGACAACTTAACAGATACTTTGACTCAACCT
AACTTAGTCCTTTAGTTGCATTAAACTCAACAAATAGAAAAGCCATTATTATCTTTCTAC
TTTGCTTTGGAGTAGGATGAAAAAGCTGGTAAATAGAACTCTTCAGTTACTTTTGGAGGT
TACGATGACTCTAAAATAGTAGGACAAATTGAGTATTTCAAGACTGTTTAACAAAATACT
TGGTTTGTAGAGTTCAATGACTTCGAAGTTGATGGAGTTAATGTATTTTCCCAAGTAAAC
TATGCTTTAATTGATACTAGCTCTCCCTTATTTTAATTCAATCCTAATATCGCAGAAAAA
TTCTAAGCAATACTAGCTTAGAGAGGAATTTACATTGGTTCAGACAACCAAATTCCCTGC
AATTCTGATCTTCCTACTATAGCTTTTACATTGCGTAATACCTAAGGAAATCTTGTGAAA
TTTGAAGTTGAACCTTCTTTCTACTTGATTTAGTCATCAAATTTATCAAATGTTTGCTAT
TTATACGTATATGGTGATTGCTAAGGTCCTGCTTTAGTTGTAGGAAGTCAATTCATTAAA
AAATATTTGACTATCTTTGATTATGAGCAAAAAACAATTGGTTTAGCTCGTTCTATTAAC
AACCCCCAATAGTCTACCTTGTAAAATTGA